DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17571 and Prss42

DIOPT Version :9

Sequence 1:NP_001286096.1 Gene:CG17571 / 35409 FlyBaseID:FBgn0259998 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_694739.1 Gene:Prss42 / 235628 MGIID:2665280 Length:335 Species:Mus musculus


Alignment Length:264 Identity:97/264 - (36%)
Similarity:151/264 - (57%) Gaps:29/264 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 VALAASCHGNPGLDF------PFGRIVNGEDVDIENYPYQVSVQTTKGSHFCGGSLIDSETVLTA 70
            |.::.:...:|.::|      ||.:|:.|.|.:...:|:||||: .:..|.||||||:|:.||||
Mouse    54 VRMSKATTRSPFMNFSLVCGQPFMKIMGGVDAEEGKWPWQVSVR-VRHMHVCGGSLINSQWVLTA 117

  Fly    71 AHCMQSYAASELQVRVGSTS--RSSGGEVVTVRAFKYHEGYNSKLMI-NDVAIIKLSSPVRQTSK 132
            |||:  |:..:..|:||..|  |.:...|:.::....|..:::.::: ||:|::||..||..|:.
Mouse   118 AHCI--YSRIQYNVKVGDRSVYRQNTSLVIPIKTIFVHPKFSTTIVVKNDIALLKLQHPVNFTTN 180

  Fly   133 IRAIEL-ADSEAV-SGTNAVVSGWGTTCFLFCSSPDT----LQKVEVDLLHYKDC---AADTYNY 188
            |..:.: ::|..| :||...|:|||.   |...:||.    ||:|:.:::.|::|   .....:.
Mouse   181 IYPVCIPSESFPVKAGTKCWVTGWGK---LVPGAPDVPTEILQEVDQNVILYEECNEMLKKATSS 242

  Fly   189 GSDSILETMVCATGEK-KDACQGDSGGPLVA--DNK--LVGVVSWGSGCAWTGYPGVYADVASLR 248
            ..|.:...|||...|: |||||||||||:..  :||  .|||||||..|...||||||.|||...
Mouse   243 SVDLVKRGMVCGYKERGKDACQGDSGGPMSCEFENKWVQVGVVSWGISCGRKGYPGVYTDVAFYS 307

  Fly   249 SWIV 252
            .|::
Mouse   308 KWLI 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17571NP_001286096.1 Tryp_SPc 30..251 CDD:214473 91/237 (38%)
Tryp_SPc 31..254 CDD:238113 92/239 (38%)
Prss42NP_694739.1 Tryp_SPc 78..309 CDD:214473 91/236 (39%)
Tryp_SPc 79..310 CDD:238113 91/236 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S5658
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.860

Return to query results.
Submit another query.