DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17571 and TPSD1

DIOPT Version :9

Sequence 1:NP_001286096.1 Gene:CG17571 / 35409 FlyBaseID:FBgn0259998 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_036349.1 Gene:TPSD1 / 23430 HGNCID:14118 Length:242 Species:Homo sapiens


Alignment Length:249 Identity:76/249 - (30%)
Similarity:116/249 - (46%) Gaps:52/249 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MNRLLLSVVALVALAASCHGNPGLDFPFGRIVNGEDVDIENYPYQVSVQTTKG---SHFCGGSLI 62
            |..|||..:.::|..|.....||.......||.|::.....:|:|||:: .:|   .||||||||
Human     8 MLSLLLLALPVLASPAYVAPAPGQALQQTGIVGGQEAPRSKWPWQVSLR-VRGPYWMHFCGGSLI 71

  Fly    63 DSETVLTAAHCMQ----SYAASELQVRVGSTSRSSGGEVVTVRAFKYHEGYN------SKLMIN- 116
            ..:.|||||||::    ..||..:|:|                  :.|..|.      |::::: 
Human    72 HPQWVLTAAHCVEPDIKDLAALRVQLR------------------EQHLYYQDQLLPVSRIIVHP 118

  Fly   117 ---------DVAIIKLSSPVRQTSKIRAIEL--ADSEAVSGTNAVVSGWG-TTCFLFCSSPDTLQ 169
                     |:|:::|..||..:|.|..:.|  |......|....|:||| ....:....|..|:
Human   119 QFYIIQTGADIALLELEEPVNISSHIHTVTLPPASETFPPGMPCWVTGWGDVDNNVHLPPPYPLK 183

  Fly   170 KVEVDLLHYKDCAADTYNYGSDS------ILETMVCATGEKKDACQGDSGGPLV 217
            :|||.::....|.|: |:.|..:      :.:.|:||..|..|:||||||||||
Human   184 EVEVPVVENHLCNAE-YHTGLHTGHSFQIVRDDMLCAGSENHDSCQGDSGGPLV 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17571NP_001286096.1 Tryp_SPc 30..251 CDD:214473 68/220 (31%)
Tryp_SPc 31..254 CDD:238113 68/219 (31%)
TPSD1NP_036349.1 Tryp_SPc 38..242 CDD:238113 68/219 (31%)
Tryp_SPc 38..240 CDD:214473 68/219 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.