DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17571 and Prss38

DIOPT Version :9

Sequence 1:NP_001286096.1 Gene:CG17571 / 35409 FlyBaseID:FBgn0259998 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_001038986.1 Gene:Prss38 / 216797 MGIID:2685095 Length:322 Species:Mus musculus


Alignment Length:261 Identity:80/261 - (30%)
Similarity:124/261 - (47%) Gaps:53/261 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 GNPGLDFPFGRIVNGEDVDIENYPYQVSVQTTKGSHFCGGSLIDSETVLTAAHC------MQSYA 78
            |.|.|.   |:::.||......:|:|||:..: |.|.||||::.:..||:||||      :::| 
Mouse    48 GQPVLQ---GKLLGGEFARDRKWPWQVSLHYS-GFHICGGSILSAYWVLSAAHCFDRGKKLETY- 107

  Fly    79 ASELQVRVGSTSRSSGG---------EVVTVRAFK-YHEGYNSKLMINDVAIIKLSSPVRQTSKI 133
                .:.||.|:.....         :|:....|: ||.      :..|||:::|.|.:..:..:
Mouse   108 ----DIYVGITNLEKANRHTQWFEIYQVIIHPTFQMYHP------IGGDVALVQLKSAIVFSDFV 162

  Fly   134 RAIELADSEA-VSGTNAVVSGWGTTCFLFCSSP-----DTLQKVEVDLLHYKDCAADTYNYG-SD 191
            ..|.|..|:. :...:...:|||..      ||     :.|.:.::.|:....|   ...|| |.
Mouse   163 LPICLPPSDLYLINLSCWTTGWGMI------SPQGETGNELLEAQLPLIPRFQC---QLLYGLSS 218

  Fly   192 SILETMVCATGEK--KDACQGDSGGPLVADNK----LVGVVSWGSGCAWTGYPGVYADVASLRSW 250
            .:|..|:||...|  |:.|:||||.|||....    .:|:||||.|||...||||:|:|:...||
Mouse   219 YLLPEMLCAADIKTMKNVCEGDSGSPLVCKQNQTWLQIGIVSWGRGCAQPLYPGVFANVSYFLSW 283

  Fly   251 I 251
            |
Mouse   284 I 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17571NP_001286096.1 Tryp_SPc 30..251 CDD:214473 74/249 (30%)
Tryp_SPc 31..254 CDD:238113 76/250 (30%)
Prss38NP_001038986.1 Tryp_SPc 58..287 CDD:238113 76/248 (31%)
Tryp_SPc 58..284 CDD:214473 74/246 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.