DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17571 and F9

DIOPT Version :10

Sequence 1:NP_610109.1 Gene:CG17571 / 35409 FlyBaseID:FBgn0259998 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_000124.1 Gene:F9 / 2158 HGNCID:3551 Length:461 Species:Homo sapiens


Alignment Length:48 Identity:7/48 - (14%)
Similarity:21/48 - (43%) Gaps:7/48 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 KPLNLTYIHMR-------GDNRTIVDGSFVIDPANKLSANYMATYQTS 122
            ||:....:.:|       .:.:|:.:..::::|..:........|:|:
Human   402 KPIPKPRVSIRKSVQIDPSEQKTLANLPWIVEPGQEAKRGINTKYETT 449

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17571NP_610109.1 Tryp_SPc 30..251 CDD:214473 7/48 (15%)
F9NP_000124.1 GLA 28..92 CDD:214503
EGF_CA 93..129 CDD:238011
FXa_inhibition 134..170 CDD:464251
Tryp_SPc 227..457 CDD:238113 7/48 (15%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.