DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17571 and Prtn3

DIOPT Version :9

Sequence 1:NP_001286096.1 Gene:CG17571 / 35409 FlyBaseID:FBgn0259998 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_035308.2 Gene:Prtn3 / 19152 MGIID:893580 Length:254 Species:Mus musculus


Alignment Length:261 Identity:77/261 - (29%)
Similarity:118/261 - (45%) Gaps:43/261 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LLLSVVALVALAASCHGNPGLDFPFGRIVNGEDVDIENYPYQVSVQTTK--GSHFCGGSLIDSET 66
            |||::|...|:.||            :||.|.:....:.||..|:|.::  |||||||:||....
Mouse    15 LLLALVVGGAVQAS------------KIVGGHEARPHSRPYVASLQLSRFPGSHFCGGTLIHPRF 67

  Fly    67 VLTAAHCMQSYAASELQVRVGS---TSRSSGGEVVTVRAFKYHEGYNSKLMINDVAIIKLSSPVR 128
            |||||||:|..:...:.|.:|:   .|.....:..|:... :...||.:..:|||.:::|:....
Mouse    68 VLTAAHCLQDISWQLVTVVLGAHDLLSSEPEQQKFTISQV-FQNNYNPEENLNDVLLLQLNRTAS 131

  Fly   129 QTSKIRAIEL--ADSEAVSGTNAVVSGW---GTTCFLFCSSPDTLQKVEVDLLHYKDCAADTYNY 188
            ...::....|  .|.....||..:..||   ||.    ..:|..||::.|.::.:. |.      
Mouse   132 LGKEVAVASLPQQDQTLSQGTQCLAMGWGRLGTQ----APTPRVLQELNVTVVTFL-CR------ 185

  Fly   189 GSDSILETMVCATGEKKDA--CQGDSGGPLVADNKLVGVVSWG-SGCAWTGYPGVYADVASLRSW 250
                  |..||....::.|  |.|||||||:.:..|.||.|:. ..||...:|..:|.|:....|
Mouse   186 ------EHNVCTLVPRRAAGICFGDSGGPLICNGILHGVDSFVIRECASLQFPDFFARVSMYVDW 244

  Fly   251 I 251
            |
Mouse   245 I 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17571NP_001286096.1 Tryp_SPc 30..251 CDD:214473 68/233 (29%)
Tryp_SPc 31..254 CDD:238113 70/234 (30%)
Prtn3NP_035308.2 Tryp_SPc 29..245 CDD:214473 68/233 (29%)
Tryp_SPc 30..248 CDD:238113 70/234 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.