DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17571 and try-1

DIOPT Version :9

Sequence 1:NP_001286096.1 Gene:CG17571 / 35409 FlyBaseID:FBgn0259998 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_494910.2 Gene:try-1 / 173856 WormBaseID:WBGene00006619 Length:293 Species:Caenorhabditis elegans


Alignment Length:230 Identity:91/230 - (39%)
Similarity:122/230 - (53%) Gaps:10/230 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 RIVNGEDVDIENYPYQVSVQTTKGSHFCGGSLIDSETVLTAAHCM-QSYAASELQVRVGSTSRSS 93
            |::.|.:....::|:.|.:.:..|.|.|||||||...|||||||. :....:...||||. .||.
 Worm    57 RLIGGSESSPHSWPWTVQLLSRLGHHRCGGSLIDPNFVLTAAHCFAKDRRPTSYSVRVGG-HRSG 120

  Fly    94 GGEVVTVRAFKYHEGYNSKLMIN-DVAIIKLSSPVRQTSKIRAIELADSEAVSGTNAVVSGWGTT 157
            .|....|.|...|..||.....: |.||:::..||..::..|.|.|....||.....||:|||:|
 Worm   121 SGSPHRVTAVSIHPWYNIGFPSSYDFAIMRIHPPVNTSTTARPICLPSLPAVENRLCVVTGWGST 185

  Fly   158 CFLFCSSPDTLQKVEVDLLHYKDCAADTYNYGSDSILETMVCA--TGEKKDACQGDSGGPLVADN 220
            ......|..||:::.|.||....|:: ..||.....|.:|:||  :..|.|:|||||||||:...
 Worm   186 IEGSSLSAPTLREIHVPLLSTLFCSS-LPNYIGRIHLPSMLCAGYSYGKIDSCQGDSGGPLMCAR 249

  Fly   221 ----KLVGVVSWGSGCAWTGYPGVYADVASLRSWI 251
                :|.||||||.|||..|.||||.:|.|..:||
 Worm   250 DGHWELTGVVSWGIGCARPGMPGVYGNVHSASTWI 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17571NP_001286096.1 Tryp_SPc 30..251 CDD:214473 89/228 (39%)
Tryp_SPc 31..254 CDD:238113 90/229 (39%)
try-1NP_494910.2 Tryp_SPc 59..285 CDD:238113 90/228 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.