powered by:
Protein Alignment CG17571 and rab-11.1
DIOPT Version :9
Sequence 1: | NP_001286096.1 |
Gene: | CG17571 / 35409 |
FlyBaseID: | FBgn0259998 |
Length: | 258 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_490675.1 |
Gene: | rab-11.1 / 171601 |
WormBaseID: | WBGene00004274 |
Length: | 211 |
Species: | Caenorhabditis elegans |
Alignment Length: | 70 |
Identity: | 14/70 - (20%) |
Similarity: | 26/70 - (37%) |
Gaps: | 21/70 - (30%) |
- Green bases have known domain annotations that are detailed below.
Fly 71 AHCMQSYAASELQVRVGST------SRSSGGEVVTVRA---------------FKYHEGYNSKLM 114
::.:..:..:|..:...|| :||...|..||:| ..|:.|....|:
Worm 25 SNLLSRFTRNEFNLESKSTIGVEFATRSISVEGKTVKAQIWDTAGQERYRAITSAYYRGAVGALL 89
Fly 115 INDVA 119
:.|:|
Worm 90 VYDIA 94
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
0 | 0.000 |
|
Return to query results.
Submit another query.