DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17571 and rab-11.1

DIOPT Version :9

Sequence 1:NP_001286096.1 Gene:CG17571 / 35409 FlyBaseID:FBgn0259998 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_490675.1 Gene:rab-11.1 / 171601 WormBaseID:WBGene00004274 Length:211 Species:Caenorhabditis elegans


Alignment Length:70 Identity:14/70 - (20%)
Similarity:26/70 - (37%) Gaps:21/70 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 AHCMQSYAASELQVRVGST------SRSSGGEVVTVRA---------------FKYHEGYNSKLM 114
            ::.:..:..:|..:...||      :||...|..||:|               ..|:.|....|:
 Worm    25 SNLLSRFTRNEFNLESKSTIGVEFATRSISVEGKTVKAQIWDTAGQERYRAITSAYYRGAVGALL 89

  Fly   115 INDVA 119
            :.|:|
 Worm    90 VYDIA 94

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17571NP_001286096.1 Tryp_SPc 30..251 CDD:214473 14/70 (20%)
Tryp_SPc 31..254 CDD:238113 14/70 (20%)
rab-11.1NP_490675.1 PLN03110 5..209 CDD:178657 14/70 (20%)
Rab11_like 9..173 CDD:206660 14/70 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.