DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17571 and CTRL

DIOPT Version :9

Sequence 1:NP_001286096.1 Gene:CG17571 / 35409 FlyBaseID:FBgn0259998 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_001898.1 Gene:CTRL / 1506 HGNCID:2524 Length:264 Species:Homo sapiens


Alignment Length:263 Identity:102/263 - (38%)
Similarity:142/263 - (53%) Gaps:22/263 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LLLSVVALVALAASCHG------NPGLDFPFGRIVNGEDVDIENYPYQVSVQTTKGSHFCGGSLI 62
            ||||:...:.|..|..|      .|.|.|. .||||||:..:.::|:|||:|.:.|.||||||||
Human     2 LLLSLTLSLVLLGSSWGCGIPAIKPALSFS-QRIVNGENAVLGSWPWQVSLQDSSGFHFCGGSLI 65

  Fly    63 DSETVLTAAHCMQSYAASELQVRVGSTSRSSGGE---VVTVRAFKYHEGYNSKLMINDVAIIKLS 124
            ....|:|||||  :.:.....|.:|...|||..|   |::|.....|..:||..|.|||.::||:
Human    66 SQSWVVTAAHC--NVSPGRHFVVLGEYDRSSNAEPLQVLSVSRAITHPSWNSTTMNNDVTLLKLA 128

  Fly   125 SPVRQTSKIRAIELADS-EAVS-GTNAVVSGWGTTCFLFCSSPDTLQKVEVDLLHYKDCAADTYN 187
            ||.:.|::|..:.||.| ||:: |...|.:|||....:...:|..||:|.:.|:....|.    .
Human   129 SPAQYTTRISPVCLASSNEALTEGLTCVTTGWGRLSGVGNVTPAHLQQVALPLVTVNQCR----Q 189

  Fly   188 YGSDSILETMVCATGEKKDACQGDSGGPLVADN----KLVGVVSWGSGCAWTGYPGVYADVASLR 248
            |...||.::|:||.|....:||||||||||...    .|:|:||||:.......|.||..|:...
Human   190 YWGSSITDSMICAGGAGASSCQGDSGGPLVCQKGNTWVLIGIVSWGTKNCNVRAPAVYTRVSKFS 254

  Fly   249 SWI 251
            :||
Human   255 TWI 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17571NP_001286096.1 Tryp_SPc 30..251 CDD:214473 90/229 (39%)
Tryp_SPc 31..254 CDD:238113 91/230 (40%)
CTRLNP_001898.1 Tryp_SPc 34..260 CDD:238113 91/230 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R10565
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.