DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17571 and PRSS36

DIOPT Version :9

Sequence 1:NP_001286096.1 Gene:CG17571 / 35409 FlyBaseID:FBgn0259998 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_775773.2 Gene:PRSS36 / 146547 HGNCID:26906 Length:855 Species:Homo sapiens


Alignment Length:289 Identity:92/289 - (31%)
Similarity:127/289 - (43%) Gaps:48/289 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LLLSVVALV-----------ALAASCHGNPGLDF----PFGRIVNGEDVDIENYPYQVSVQTTKG 53
            |||.:|.||           ||:.:......||.    |..|||.|.:.....:|:|||:. ..|
Human     5 LLLPLVMLVISPIPGAFQDSALSPTQEEPEDLDCGRPEPSARIVGGSNAQPGTWPWQVSLH-HGG 68

  Fly    54 SHFCGGSLIDSETVLTAAHCMQSYA----ASELQVRVGSTSRS---SGGEVVTVRAFKYHEGYNS 111
            .|.||||||....||:||||..:..    |:|..|.:|..|:.   .|.....|.|......|:.
Human    69 GHICGGSLIAPSWVLSAAHCFMTNGTLEPAAEWSVLLGVHSQDGPLDGAHTRAVAAIVVPANYSQ 133

  Fly   112 KLMINDVAIIKLSSPVRQTSKIRAIEL--ADSEAVSGTNAVVSGWGTTCFLFCSSPD------TL 168
            ..:..|:|:::|:||......:..:.|  |....|.||....:|||..     ...|      .|
Human   134 VELGADLALLRLASPASLGPAVWPVCLPRASHRFVHGTACWATGWGDV-----QEADPLPLPWVL 193

  Fly   169 QKVEVDLLHYKDCAA-----DTYNYGSDSILETMVCA--TGEKKDACQGDSGGPLVADNK----L 222
            |:||:.||....|..     ..:|. :..||..|:||  ...::|.||||||||||.:..    .
Human   194 QEVELRLLGEATCQCLYSQPGPFNL-TLQILPGMLCAGYPEGRRDTCQGDSGGPLVCEEGGRWFQ 257

  Fly   223 VGVVSWGSGCAWTGYPGVYADVASLRSWI 251
            .|:.|:|.||.....|||:..||:..:||
Human   258 AGITSFGFGCGRRNRPGVFTAVATYEAWI 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17571NP_001286096.1 Tryp_SPc 30..251 CDD:214473 79/246 (32%)
Tryp_SPc 31..254 CDD:238113 80/247 (32%)
PRSS36NP_775773.2 Tryp_SPc 46..286 CDD:214473 79/246 (32%)
Tryp_SPc 47..289 CDD:238113 80/247 (32%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 292..316
Tryp_SPc 330..538 CDD:304450
Tryp_SPc 601..783 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165149415
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.