DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17571 and Prss28

DIOPT Version :9

Sequence 1:NP_001286096.1 Gene:CG17571 / 35409 FlyBaseID:FBgn0259998 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_444489.2 Gene:Prss28 / 114661 MGIID:2149951 Length:274 Species:Mus musculus


Alignment Length:278 Identity:84/278 - (30%)
Similarity:127/278 - (45%) Gaps:36/278 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MNRLLLSVVALVALAASCHGNP--------GLDFPFGRIVNGEDVDIENYPYQVSV-----QTTK 52
            |.||||       ||.||..:.        ....|.| ||.|:......:|:|||:     :...
Mouse     1 MFRLLL-------LALSCLESTVFMASVSISRSKPVG-IVGGQCTPPGKWPWQVSLRMYSYEVNS 57

  Fly    53 GSHFCGGSLIDSETVLTAAHCMQSYAA--SELQVRVGSTSRSSGGEVVTVRAFKYHEGYNSKLMI 115
            ..|.||||:|..:.:||||||:||..|  :..:|:||........|::.:.....|..||.....
Mouse    58 WVHICGGSIIHPQWILTAAHCIQSQDADPAVYRVQVGEVYLYKEQELLNISRIIIHPDYNDVSKR 122

  Fly   116 NDVAIIKLSSPVRQTSKIRAIEL-ADSEAVSGTNAV-VSGWGTTC-FLFCSSPDTLQKVEVDLLH 177
            .|:|:::|::.:..::.:..:.| .||.....|:.. :.|||... .:....|..|.:|::.:..
Mouse   123 FDLALMQLTALLVTSTNVSPVSLPKDSSTFDSTDQCWLVGWGNLLQRVPLQPPYQLHEVKIPIQD 187

  Fly   178 YKDCAADTYNYGSD-----SILETMVCATGEKKDACQGDSGGPLVA--DNK--LVGVVSWGSGCA 233
            .|.|........||     :|.:.|:||....:..|.||||||||.  .||  .|||||.|..|:
Mouse   188 NKSCKRAYRKKSSDEHKAVAIFDDMLCAGTSGRGPCFGDSGGPLVCWKSNKWIQVGVVSKGIDCS 252

  Fly   234 WTGYPGVYADVASLRSWI 251
             ...|.:::.|.|..:||
Mouse   253 -NNLPSIFSRVQSSLAWI 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17571NP_001286096.1 Tryp_SPc 30..251 CDD:214473 71/239 (30%)
Tryp_SPc 31..254 CDD:238113 73/240 (30%)
Prss28NP_444489.2 Tryp_SPc 31..272 CDD:238113 73/240 (30%)
Tryp_SPc 31..269 CDD:214473 71/238 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.