DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17571 and LOC105945797

DIOPT Version :9

Sequence 1:NP_001286096.1 Gene:CG17571 / 35409 FlyBaseID:FBgn0259998 Length:258 Species:Drosophila melanogaster
Sequence 2:XP_031761518.1 Gene:LOC105945797 / 105945797 -ID:- Length:243 Species:Xenopus tropicalis


Alignment Length:258 Identity:91/258 - (35%)
Similarity:134/258 - (51%) Gaps:26/258 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 RLLLSVVALVALAASCHGNPGLDFPFGRIVNGEDVDIENYPYQVSVQTTKGSHFCGGSLIDSETV 67
            :|||..|.|.|.||         |...:||.|......:.||.||:..  |.||||||||.|:.|
 Frog     2 KLLLLCVLLGAAAA---------FDDDKIVGGYTCAPNSVPYIVSLNA--GYHFCGGSLISSQWV 55

  Fly    68 LTAAHCMQSYAASELQVRVG--STSRSSGGE--VVTVRAFKYHEGYNSKLMINDVAIIKLSSPVR 128
            ::||||..    ::::||:|  ....:.|.|  :.:.:..| ::||:.:.:.||:.:|||::|..
 Frog    56 VSAAHCFM----NKIEVRLGEHDIKATEGTEQFINSAKVIK-NKGYSPRTLDNDIMLIKLATPAI 115

  Fly   129 QTSKIRAIELADSEAVSGTNAVVSGWGTTCFLFCSSPDTLQKVEVDLLHYKDCAADTYNYGSDSI 193
            ....:..:.|.........|.::||||.|.....:.|:.||.|...:|...:|   ...|..: |
 Frog   116 LNQYVSPVPLPSGCIEPRANCLISGWGNTLSSGSNYPNLLQCVSAPVLTADEC---NKAYPGE-I 176

  Fly   194 LETMVCA--TGEKKDACQGDSGGPLVADNKLVGVVSWGSGCAWTGYPGVYADVASLRSWIVDT 254
            .:.|:|.  ....||:||||||||:|.:.:|.|:||||.|||...|||||..|.:..:||..|
 Frog   177 TQNMICVGFLEGGKDSCQGDSGGPVVCNGELQGIVSWGYGCAEKNYPGVYTKVCNYNAWIEST 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17571NP_001286096.1 Tryp_SPc 30..251 CDD:214473 79/226 (35%)
Tryp_SPc 31..254 CDD:238113 81/228 (36%)
LOC105945797XP_031761518.1 Tryp_SPc 21..239 CDD:238113 81/228 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.