DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17571 and Try5

DIOPT Version :9

Sequence 1:NP_001286096.1 Gene:CG17571 / 35409 FlyBaseID:FBgn0259998 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_001003405.1 Gene:Try5 / 103964 MGIID:102756 Length:246 Species:Mus musculus


Alignment Length:263 Identity:103/263 - (39%)
Similarity:146/263 - (55%) Gaps:30/263 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MNRLLLSVVALVALAASCHGNPGLDFPF---GRIVNGEDVDIENYPYQVSVQTTKGSHFCGGSLI 62
            ||.||.  :|||..|.:        ||.   .:||.|......:.|||||:.:  |.||||||||
Mouse     1 MNSLLF--LALVGAAVA--------FPVDDDDKIVGGYTCRENSIPYQVSLNS--GYHFCGGSLI 53

  Fly    63 DSETVLTAAHCMQSYAASELQVRVGSTSRS--SGGE--VVTVRAFKYHEGYNSKLMINDVAIIKL 123
            :.:.|::||||.:    :.:|||:|..:.:  .|.|  |.:.:..| |..:||:.:.||:.:|||
Mouse    54 NDQWVVSAAHCYK----TRIQVRLGEHNINVLEGNEQFVNSAKIIK-HPNFNSRTLNNDIMLIKL 113

  Fly   124 SSPVRQTSKIRAIELADSEAVSGTNAVVSGWGTTCFLFCSSPDTLQKVEVDLLHYKDCAADTYNY 188
            :|||...:::..:.|..|.|.:||..::||||.|.....::||.||.::..||...||.|   :|
Mouse   114 ASPVTLNARVATVALPSSCAPAGTQCLISGWGNTLSFGVNNPDLLQCLDAPLLPQADCEA---SY 175

  Fly   189 GSDSILETMVCA--TGEKKDACQGDSGGPLVADNKLVGVVSWGSGCAWTGYPGVYADVASLRSWI 251
             ...|...|:|.  ....||:||||||||:|.:.:|.|:||||.|||....||||..|.:...||
Mouse   176 -PGKITNNMICVGFLEGGKDSCQGDSGGPVVCNGQLQGIVSWGYGCALKDNPGVYTKVCNYVDWI 239

  Fly   252 VDT 254
            .||
Mouse   240 QDT 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17571NP_001286096.1 Tryp_SPc 30..251 CDD:214473 89/226 (39%)
Tryp_SPc 31..254 CDD:238113 91/228 (40%)
Try5NP_001003405.1 Tryp_SPc 23..239 CDD:214473 89/226 (39%)
Tryp_SPc 24..242 CDD:238113 91/228 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.