DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nrv3 and Atp1b4

DIOPT Version :9

Sequence 1:NP_001260675.1 Gene:nrv3 / 35408 FlyBaseID:FBgn0032946 Length:313 Species:Drosophila melanogaster
Sequence 2:NP_445833.2 Gene:Atp1b4 / 84396 RGDID:620994 Length:356 Species:Rattus norvegicus


Alignment Length:323 Identity:82/323 - (25%)
Similarity:131/323 - (40%) Gaps:90/323 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 KFLWNSETSQCLGRTGSSWAKILLFYIIFYAALTGFFAAIFTVFYQTL------------DNEKP 76
            ::||:.|....|.|||.|.:.||:.|..|||:|    ||:.|:|...|            :..||
  Rat    90 EYLWDPEKRMSLARTGQSRSLILVIYFFFYASL----AAVITLFIYMLFLAISPYMPTFTEQVKP 150

  Fly    77 KWMLDNGLIGSNPGLGFRPMPPEANVESTLVWYESSKKDNYKYWVDETSRFLKYHTYQD-LEKQN 140
                        ||:..||.....|..     :..|:.:.::.:|...:.||:  .|.| |:::.
  Rat   151 ------------PGVMIRPFAHSLNFN-----FNVSEPETWQRYVISLNGFLQ--GYNDSLQEEM 196

  Fly   141 QVNCSFEHPP-----------QDDKVCGIDFSSFSPCTA--DNNFGYHVARPCIFLKLNKIYNWI 192
            .::|    ||           :|.|.|....|....|:.  |..|||...:|||.||:|:|..:.
  Rat   197 NIDC----PPGQYFIQDGDEDEDKKACQFKRSFLKNCSGLEDPTFGYSTGQPCILLKMNRIVGFR 257

  Fly   193 PEIYNDSKTLPDHMPEELKQHIKEKQSLRPNETNVVWVSCEGENPADVENIKARDYYPR-MGFPR 256
            ||..:..|                             |||:.:. .|..||::.:|||. ..|..
  Rat   258 PEFGDPVK-----------------------------VSCKVQK-GDENNIRSINYYPESASFDL 292

  Fly   257 YYFPF---KNIQGYIPPIVAVQFT-VETGVLINIECKAWARNINHDRSDRR--GSVHFELMVD 313
            .|:|:   .....|..|:||:.|| |.....:.::|:...:.|.:|..:.|  |.:.|.|.::
  Rat   293 RYYPYYGKLTHVNYTSPLVAMHFTDVVKNQEVPVQCQLKGKGIVNDVINDRFVGRIIFTLNIE 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nrv3NP_001260675.1 Na_K-ATPase 20..307 CDD:395224 80/315 (25%)
Atp1b4NP_445833.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 32..77
Na_K-ATPase 90..348 CDD:395224 80/314 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 137 1.000 Domainoid score I4756
eggNOG 1 0.900 - - E1_KOG3927
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 137 1.000 Inparanoid score I4445
OMA 1 1.010 - - QHG45736
OrthoDB 1 1.010 - - D422722at33208
OrthoFinder 1 1.000 - - FOG0000357
OrthoInspector 1 1.000 - - mtm9102
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR11523
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X254
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1110.980

Return to query results.
Submit another query.