DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nrv3 and atp1b1a

DIOPT Version :9

Sequence 1:NP_001260675.1 Gene:nrv3 / 35408 FlyBaseID:FBgn0032946 Length:313 Species:Drosophila melanogaster
Sequence 2:NP_571743.3 Gene:atp1b1a / 64267 ZFINID:ZDB-GENE-001127-3 Length:306 Species:Danio rerio


Alignment Length:322 Identity:96/322 - (29%)
Similarity:150/322 - (46%) Gaps:61/322 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 GFKKFLWNSETSQCLGRTGSSWAKILLFYIIFYAALTGFFAAIFTVFYQTLDNEKPKWMLDNGLI 85
            |:|.|:|||:..:.|||||.||.||.:||:|||..|.|.|.........||.|.||.:. |.   
Zfish    10 GWKSFIWNSDKKEFLGRTGCSWLKIFIFYVIFYGCLAGIFIGTIQAMLLTLSNYKPTYQ-DR--- 70

  Fly    86 GSNPGLGFRPMPPEANVESTLVWYESSKKDNYKYWVDETSRFLKYHTYQDLEKQNQVNCSFEH-- 148
            .:.|||...|.|.:|.:.     |..:.:..|..:|:....|||.:. :|::|.   :..||.  
Zfish    71 VAPPGLSHSPRPDKAEIN-----YNINDESTYLPYVNHIDAFLKAYN-EDVQKD---DTKFEECG 126

  Fly   149 -PPQ----------DD---KVCGIDFSSFSPCTAD-----NNFGYHVARPCIFLKLNKIYNWIPE 194
             .||          |:   |.|.........|:..     .|:|:...:||:.:|||:|.|::|.
Zfish   127 DKPQFYTDRGELESDNGVRKACRFRREWLGECSGQKDEKLKNYGFDDGQPCLIVKLNRIVNFMPR 191

  Fly   195 --IYNDSKTLPDHMPEELKQHIKEKQSLRPN-ETNVVWVSCEGENPADVENIKARDYYP-RMGFP 255
              ..|||      :||          ::||. :.||:.:.|..:...:...:....|:. ..|||
Zfish   192 PPASNDS------IPE----------AVRPKLQGNVIPIHCSSKREEEANLLGQIKYFGLGTGFP 240

  Fly   256 RYYFPF--KNIQ-GYIPPIVAVQF-TVETGVLINIECKAWARNINH---DRSDRRGSVHFEL 310
            ..|:|:  |.:| .|:.|:||::| .:.|.|.:.:|||.:..||::   |||..|..:.|.:
Zfish   241 LQYYPYYGKLLQPQYLQPLVAIKFYNITTDVDVRVECKVYGENIDYSEKDRSQGRFDIKFTI 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nrv3NP_001260675.1 Na_K-ATPase 20..307 CDD:395224 95/317 (30%)
atp1b1aNP_571743.3 Na_K-ATPase 8..303 CDD:298651 96/322 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 125 1.000 Domainoid score I5399
eggNOG 1 0.900 - - E1_KOG3927
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H37509
Inparanoid 1 1.050 125 1.000 Inparanoid score I4678
OMA 1 1.010 - - QHG45736
OrthoDB 1 1.010 - - D422722at33208
OrthoFinder 1 1.000 - - FOG0000357
OrthoInspector 1 1.000 - - mtm6361
orthoMCL 1 0.900 - - OOG6_104632
Panther 1 1.100 - - O PTHR11523
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4478
SonicParanoid 1 1.000 - - X254
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1514.870

Return to query results.
Submit another query.