DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nrv3 and CG11703

DIOPT Version :9

Sequence 1:NP_001260675.1 Gene:nrv3 / 35408 FlyBaseID:FBgn0032946 Length:313 Species:Drosophila melanogaster
Sequence 2:NP_650792.1 Gene:CG11703 / 42307 FlyBaseID:FBgn0038690 Length:353 Species:Drosophila melanogaster


Alignment Length:307 Identity:76/307 - (24%)
Similarity:127/307 - (41%) Gaps:70/307 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 FKKFLWNSETSQCLGRTGSSWAKILLFYIIFYA---ALTGFFAAIFTVFYQTLDNEKPKWMLDNG 83
            :.|.:::.:..:..|||...|.:|..||::.||   .:..|:..||.:  ..:|..||:|     
  Fly    32 WSKRIFDIDEHKLFGRTALGWMRITGFYLVLYALIVCIVAFWLGIFML--AIIDPNKPRW----- 89

  Fly    84 LIGSNPGLGFRPMPPEANVESTLVWYESSKKDNYKYWVDETSRFLKYHTYQDLEKQNQVNCSFEH 148
             :...|||...|     |...:::.|.:..........|....||           |::|.:   
  Fly    90 -LKGPPGLSMVP-----NQNRSVLAYFTHIMSEVNPIADRIDDFL-----------NKLNDN--- 134

  Fly   149 PPQDDKVCGIDFSSFSPCTADNNFGYHVARPCIFLKLNKIYNWIPEIYNDSKTLPDHMPEELKQH 213
                    .|||  |:....|..:||...:|.:|:||||:..::||.|:    .||.:|:|....
  Fly   135 --------AIDF--FADFNQDTTWGYATEKPTVFIKLNKVIGYVPETYD----TPDDLPKEAPAS 185

  Fly   214 IKEKQSLRPNETNVVWVSCEGENPADVENIKARDYYPRMGFPRYYFPFKNIQGYIPPIVAVQFT- 277
            :::......| |..:|::||..|....|.:    :||    ..|:...:|::| :..:||:|.. 
  Fly   186 LQDTVGKLGN-TPKIWITCEVTNGPKPEMV----FYP----GPYFEASENMRG-VTRVVAIQMNK 240

  Fly   278 VETGVLINIECKAWARNINHD---------------RSDRRGSVHFE 309
            :.........||.|||||..|               |:|..|:..||
  Fly   241 MPENAKTFFSCKVWARNIPIDDDYQGMGIIKFALSMRTDDDGNPDFE 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nrv3NP_001260675.1 Na_K-ATPase 20..307 CDD:395224 74/303 (24%)
CG11703NP_650792.1 Na_K-ATPase 32..267 CDD:298651 71/285 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45473156
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3927
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D422722at33208
OrthoFinder 1 1.000 - - FOG0000357
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11523
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.