DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nrv3 and atp1b3

DIOPT Version :9

Sequence 1:NP_001260675.1 Gene:nrv3 / 35408 FlyBaseID:FBgn0032946 Length:313 Species:Drosophila melanogaster
Sequence 2:NP_989087.1 Gene:atp1b3 / 394687 XenbaseID:XB-GENE-485127 Length:279 Species:Xenopus tropicalis


Alignment Length:313 Identity:89/313 - (28%)
Similarity:149/313 - (47%) Gaps:73/313 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 FKKFLWNSETSQCLGRTGSSWAKILLFYIIFYAALTGFFAAIFTVFYQTLDNEKPKWMLDNGLIG 86
            :|:|::|.::.:.:|||.||||.|||||::||..|.|.|.....|..||||:..||:. |.   .
 Frog    16 WKQFIYNPQSGEFMGRTASSWALILLFYLVFYGFLAGLFTLTMWVMLQTLDDSVPKYR-DR---V 76

  Fly    87 SNPGLGFRPMPPEANVESTLVWYESSKKDNYKYWVDETSRFLKYHTYQD-LEKQNQVNCS----F 146
            |:|||..  .|..|.:|   :.:..:|..:|:.::.....||.  .|.| ::.:|.: |:    |
 Frog    77 SSPGLMI--SPKSAGLE---IKFTRNKTQSYQEYIQTLHTFLT--PYNDAIQAKNDL-CAPGLYF 133

  Fly   147 EHPPQDD-KVCGIDFSSFSPCTA--DNNFGYHVARPCIFLKLNKIYNWIPEIYNDSKTLPDHMPE 208
            :...:|: |.|..:.||...|:.  ||.|||:..:||:.:|:|:|....||  .:.|        
 Frog   134 DQDEKDEKKACQFNRSSLGLCSGIEDNTFGYNEGKPCVIVKMNRIIGLKPE--GNPK-------- 188

  Fly   209 ELKQHIKEKQSLRPNETNVVWVSCEGENPADVENIKARDYYPRMG-FPRYYFPF---KNIQGYIP 269
                                 ::|..:    .|::..: |:|..| ....|||:   |....|:.
 Frog   189 ---------------------INCTSK----TEDVNLQ-YFPENGKIDLMYFPYYGKKTHVNYVQ 227

  Fly   270 PIVAVQF-------TVETGVLINIECKA-WARNI-NHDRSDR-RGSVHFELMV 312
            |:|||:.       :::.   |::|||. .:||: |.|..|: .|.|.|::.:
 Frog   228 PLVAVKIIPPPYNSSLDE---ISLECKIHGSRNLKNEDERDKFLGRVTFKVKI 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nrv3NP_001260675.1 Na_K-ATPase 20..307 CDD:395224 87/306 (28%)
atp1b3NP_989087.1 Na_K-ATPase 14..272 CDD:366001 87/306 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 124 1.000 Domainoid score I5426
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 124 1.000 Inparanoid score I4563
OMA 1 1.010 - - QHG45736
OrthoDB 1 1.010 - - D422722at33208
OrthoFinder 1 1.000 - - FOG0000357
OrthoInspector 1 1.000 - - mtm9519
Panther 1 1.100 - - O PTHR11523
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X254
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1111.080

Return to query results.
Submit another query.