DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nrv3 and atp1b2

DIOPT Version :9

Sequence 1:NP_001260675.1 Gene:nrv3 / 35408 FlyBaseID:FBgn0032946 Length:313 Species:Drosophila melanogaster
Sequence 2:NP_989070.1 Gene:atp1b2 / 394667 XenbaseID:XB-GENE-1007085 Length:306 Species:Xenopus tropicalis


Alignment Length:329 Identity:93/329 - (28%)
Similarity:143/329 - (43%) Gaps:77/329 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 FKKFLWNSETSQCLGRTGSSWAKILLFYIIFYAALTGFFAAIFTVFYQTLDNEKPKWMLDNGLIG 86
            ||:|:||..|.:.:|||.|||..|:.||::|||.|||.||....|..||:|...||:.  :.|  
 Frog    17 FKEFMWNPRTREFMGRTASSWGLIVSFYLVFYAFLTGMFALSMYVMLQTIDEYTPKYW--DRL-- 77

  Fly    87 SNPGLGFRPMPPEANVESTLVWYESSKKDNYKYWVDETSRFLKYHTYQDLEKQNQVNCSFEHPPQ 151
            ::|||..||     ..::..:.|..|...::..:|.:.:..|..:......:|..|..|.....|
 Frog    78 TSPGLMIRP-----KTDTLEIVYSISGNSSWAPYVSQLNSMLDPYNDTVQMQQGSVCPSGVFNKQ 137

  Fly   152 DD---------KVCGIDFSSFSPCT--ADNNFGYHVARPCIFLKLNKIYNWIPEIYNDSKTLPDH 205
            ||         |.|....||...|:  .|..:||....||:.:|:|||.|:.|.:.         
 Frog   138 DDTGDVRNYPKKACQFLRSSLGDCSGLTDPTYGYSTGSPCLLIKMNKIINFYPGVI--------- 193

  Fly   206 MPEELKQHIKEKQSLRPNETNV-VWVSCEGENPADVENIKARDYYPRMG-------------FPR 256
                            |:.:|. :.::|.|......:.:.:|.|||...             ...
 Frog   194 ----------------PSLSNTSITINCTGTTANMDQMLGSRTYYPSSNPSNGTSNGTSLGTMDL 242

  Fly   257 YYFPF------KNIQGYIPPIVAVQFTVETGVLIN----IECKAWARNIN-HDRSDR-RGSVHFE 309
            .|||:      ||   |..|:|||:|   ..:.:|    ::|:|.|.||| :|..|: .|.|.|:
 Frog   243 MYFPYYGNRAQKN---YSQPLVAVKF---YNLTLNQDLYVQCRANAVNINTNDSQDKFSGRVSFK 301

  Fly   310 LMVD 313
            |.::
 Frog   302 LHIN 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nrv3NP_001260675.1 Na_K-ATPase 20..307 CDD:395224 90/321 (28%)
atp1b2NP_989070.1 Na_K-ATPase 15..299 CDD:366001 90/321 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 124 1.000 Domainoid score I5426
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 124 1.000 Inparanoid score I4563
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D422722at33208
OrthoFinder 1 1.000 - - FOG0000357
OrthoInspector 1 1.000 - - mtm9519
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4478
SonicParanoid 1 1.000 - - X254
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.090

Return to query results.
Submit another query.