DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment nrv3 and GABA-B-R1

DIOPT Version :9

Sequence 1:	NP_001260675.1	Gene:	nrv3 / 35408	FlyBaseID:	FBgn0032946	Length:	313	Species:	Drosophila melanogaster
Sequence 2:	NP_001246033.1	Gene:	GABA-B-R1 / 34878	FlyBaseID:	FBgn0260446	Length:	841	Species:	Drosophila melanogaster

Alignment Length:	60	Identity:	16/60 - (26%)
Similarity:	20/60 - (33%)	Gaps:	25/60 - (41%)

- Green bases have known domain annotations that are detailed below.

  Fly    21 GFKKFLWNSETSQCLGRTGSSWAKILLFYIIFYAALTGFFAAIFTVFYQTLDNEKPKWML 80
            |||..| :|..|:|....|:|                        |.|..|.|:..|.||
  Fly    73 GFKLIL-HSNDSECEPGLGAS------------------------VMYNLLYNKPQKLML 107

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
nrv3	NP_001260675.1	Na_K-ATPase	20..307	CDD:395224	16/60 (27%)
GABA-B-R1	NP_001246033.1	PBP1_GABAb_receptor	34..437	CDD:107361	16/60 (27%)
		ANF_receptor	52..415	CDD:279440	16/60 (27%)
		7tm_3	476..730	CDD:278433
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG3927
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
	1	0.900