DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nrv3 and CG33310

DIOPT Version :9

Sequence 1:NP_001260675.1 Gene:nrv3 / 35408 FlyBaseID:FBgn0032946 Length:313 Species:Drosophila melanogaster
Sequence 2:NP_995718.2 Gene:CG33310 / 2768910 FlyBaseID:FBgn0053310 Length:876 Species:Drosophila melanogaster


Alignment Length:327 Identity:73/327 - (22%)
Similarity:129/327 - (39%) Gaps:66/327 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 EYYAPPVKMGKWEGFKKFLWNSETSQCLGRTGSSWAKILLFYIIFYAALTGFFAAIFTVFYQTLD 72
            ||:.|    |:.| :::..:|....:...|..|.|...|:|.:::...:..|..|.|........
  Fly   575 EYHFP----GRTE-WRRLFFNKIHGKYKLRRPSHWLYTLVFSVLYILFVIIFSMAWFDFIKDDAS 634

  Fly    73 NEKPKWMLDNGLIGSNPGLGFRPMPPEANVESTLVWYESSKKDNYKYWVDETSRFLKYHTYQDLE 137
            .:.|...:      :.|.:.|.|:.|..|.::......:|.:...|| ....:...||..|    
  Fly   635 RKVPMIKM------AQPFISFTPIGPRTNPKAVSFDPRNSTEVMEKY-AGIMALLEKYGDY---- 688

  Fly   138 KQNQVNCSFEHPPQDDKVCGIDFSSFSPCTADNNFGYHVARPCIFLKLNKIYNWIPEIYNDSKTL 202
                     .|.|:           |..|||:..|||....||:|||:|:|..:..|.|.:|..|
  Fly   689 ---------GHNPR-----------FGTCTANEKFGYPSGEPCVFLKVNRIIGFKTEPYINSDEL 733

  Fly   203 PDHMPEELK----QHIKEKQSLRPNETNVVWVSCEGE-----------NPA------DVENIKAR 246
            .....:|::    :.:.|..:......|..|::|..:           .||      |:|  :..
  Fly   734 VKAKIDEVEFTALKRLLENTTTEEGHLNRTWITCRSDKDKNVLIEFHPEPAIRTEYTDIE--EKI 796

  Fly   247 DYYPRMGFPRYYFPFKNIQGYIPPIVAVQF-TVETGVLINIECKAWARNINHDRSDRRGSVHFEL 310
            :|....|...::.|     ..:..|||::. .::....::|.||.||:||:| |.:..|.|.|.:
  Fly   797 EYIANEGKKSFFGP-----NDVNRIVALKIKNLKANERVHINCKMWAQNIHH-RKEGYGQVSFFV 855

  Fly   311 MV 312
            ::
  Fly   856 LL 857

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nrv3NP_001260675.1 Na_K-ATPase 20..307 CDD:395224 67/308 (22%)
CG33310NP_995718.2 Na_K-ATPase <703..847 CDD:298651 38/151 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45473153
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D422722at33208
OrthoFinder 1 1.000 - - FOG0000357
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11523
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.