DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nrv3 and Shbg

DIOPT Version :9

Sequence 1:NP_001260675.1 Gene:nrv3 / 35408 FlyBaseID:FBgn0032946 Length:313 Species:Drosophila melanogaster
Sequence 2:XP_006246648.1 Gene:Shbg / 24775 RGDID:3671 Length:445 Species:Rattus norvegicus


Alignment Length:179 Identity:39/179 - (21%)
Similarity:61/179 - (34%) Gaps:40/179 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 YAPPVKMGKW-------EGFKKFLW-NSETSQCLGRTGSSWA-------KILLFYII-------- 51
            :.|.:..|:|       .|....|| :.:...||.:..:|.|       :|.|..::        
  Rat   163 FGPRLNDGRWHPVELKMNGDSLLLWVDGKEMLCLRQVSASLADHPQLSMRIALGGLLLPTSKLRF 227

  Fly    52 -FYAALTGFFAAIFTVFYQTLDNEKPKWMLDNGLIGSNPGLGFRPMPPEANVESTLVWYESSKKD 115
             ...||.|.......:.:|...:...:..|.|..:...|||.|   ||..:.|.:|........|
  Rat   228 PLVPALDGCIRRDIWLGHQAQLSTSARTSLGNCDVDLQPGLFF---PPGTHAEFSLQDIPQPHTD 289

  Fly   116 NYKY-------WVDETSRFLKYHT-----YQDLEKQNQ-VNCSFEHPPQ 151
            .:.:       .||...|.|...|     :..|..|:| |..|.|..|:
  Rat   290 PWTFSLELGFKLVDGAGRLLTLGTGTNSSWLTLHLQDQTVVLSSEAEPK 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nrv3NP_001260675.1 Na_K-ATPase 20..307 CDD:395224 36/162 (22%)
ShbgXP_006246648.1 Laminin_G_1 118..248 CDD:278483 16/84 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3927
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.