DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nrv3 and ATP1B4

DIOPT Version :9

Sequence 1:NP_001260675.1 Gene:nrv3 / 35408 FlyBaseID:FBgn0032946 Length:313 Species:Drosophila melanogaster
Sequence 2:NP_001135919.1 Gene:ATP1B4 / 23439 HGNCID:808 Length:357 Species:Homo sapiens


Alignment Length:347 Identity:89/347 - (25%)
Similarity:141/347 - (40%) Gaps:93/347 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 DKKIGEYYAPPVKMGKWEGFK---KFLWNSETSQCLGRTGSSWAKILLFYIIFYAALTGFFAAIF 64
            :|:..|....|.....|:..:   ::||:.|....|.|||.||:.|||.|..|||:|    ||:.
Human    67 EKEEEEGQGQPTGNAWWQKLQIMSEYLWDPERRMFLARTGQSWSLILLIYFFFYASL----AAVI 127

  Fly    65 TVFYQTL------------DNEKPKWMLDNGLIGSNPGLGFRPMPPEANVESTLVWYESSKKDNY 117
            |:...||            :..||            ||:..||.....|..     :..|:.|.:
Human   128 TLCMYTLFLTISPYIPTFTERVKP------------PGVMIRPFAHSLNFN-----FNVSEPDTW 175

  Fly   118 KYWVDETSRFLKYHTYQD-LEKQNQVNCSFEHPP-----------QDDKVCGIDFSSFSPCTA-- 168
            :::|...:.||:  .|.| |:::..|:|    ||           :|.|.|....|....|:.  
Human   176 QHYVISLNGFLQ--GYNDSLQEEMNVDC----PPGQYFIQDGNEDEDKKACQFKRSFLKNCSGLE 234

  Fly   169 DNNFGYHVARPCIFLKLNKIYNWIPEIYNDSKTLPDHMPEELKQHIKEKQSLRPNETNVVWVSCE 233
            |..|||...:|||.||:|:|..:.||:.:..|                             |||:
Human   235 DPTFGYSTGQPCILLKMNRIVGFRPELGDPVK-----------------------------VSCK 270

  Fly   234 GENPADVENIKARDYYPR-MGFPRYYFPF---KNIQGYIPPIVAVQFT-VETGVLINIECKAWAR 293
            .:. .|..:|::..|||. ..|...|:|:   .....|..|:||:.|| |.....:.::|:...:
Human   271 VQR-GDENDIRSISYYPESASFDLRYYPYYGKLTHVNYTSPLVAMHFTDVVKNQAVPVQCQLKGK 334

  Fly   294 NINHDRSDRR--GSVHFELMVD 313
            .:.:|..:.|  |.|.|.|.::
Human   335 GVINDVINDRFVGRVIFTLNIE 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nrv3NP_001260675.1 Na_K-ATPase 20..307 CDD:395224 82/322 (25%)
ATP1B4NP_001135919.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 15..80 3/12 (25%)
Na_K-ATPase 82..351 CDD:306737 84/325 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 139 1.000 Domainoid score I4783
eggNOG 1 0.900 - - E1_KOG3927
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 139 1.000 Inparanoid score I4506
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG45736
OrthoDB 1 1.010 - - D422722at33208
OrthoFinder 1 1.000 - - FOG0000357
OrthoInspector 1 1.000 - - mtm8622
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR11523
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X254
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1110.980

Return to query results.
Submit another query.