DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nrv3 and Atp1b2

DIOPT Version :9

Sequence 1:NP_001260675.1 Gene:nrv3 / 35408 FlyBaseID:FBgn0032946 Length:313 Species:Drosophila melanogaster
Sequence 2:NP_038201.1 Gene:Atp1b2 / 11932 MGIID:88109 Length:290 Species:Mus musculus


Alignment Length:318 Identity:91/318 - (28%)
Similarity:142/318 - (44%) Gaps:68/318 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 EGFKKFLWNSETSQCLGRTGSSWAKILLFYIIFYAALTGFFAAIFTVFYQTLDNEKPKWMLDNGL 84
            |.:|:|:||..|.|.:||||:|||.|||||::||..||..|:....|..||:.:..||:  .:.|
Mouse    15 EEWKEFVWNPRTHQFMGRTGTSWAFILLFYLVFYGFLTAMFSLTMWVMLQTVSDHTPKY--QDRL 77

  Fly    85 IGSNPGLGFRPMPPE----ANVESTLVWYESSKKDNYKYWVDETSRFLKYHTYQD-LEKQNQVNC 144
              :.|||..||....    .|:..|..|.:..:|.|         :||:  .|.| ::.|....|
Mouse    78 --ATPGLMIRPKTENLDVIVNISDTESWGQHVQKLN---------KFLE--PYNDSIQAQKNDVC 129

  Fly   145 S----FEHPPQ-----DDKVCGIDFSSFSPCTA---DNNFGYHVARPCIFLKLNKIYNWIPEIYN 197
            .    :|.|..     ..:.|..:.:....|:.   ..::||...:||:|:|:|::.|:      
Mouse   130 RPGRYYEQPDNGVLNYPKRACQFNRTQLGDCSGIGDPTHYGYSTGQPCVFIKMNRVINF------ 188

  Fly   198 DSKTLPDHMPEELKQHIKEKQSLRPNETNVVWVSCEGENPADVENIKARDYYPRMG-FPRYYFPF 261
                           :....||:.        |:|.|:...|.||:.....:|..| ....|||:
Mouse   189 ---------------YAGANQSMN--------VTCVGKRDEDAENLGHFVMFPANGSIDLMYFPY 230

  Fly   262 ---KNIQGYIPPIVAVQF-TVETGVLINIECKAWARNI--NHDRSDRRGSVHFELMVD 313
               |....|..|:|||:| .|...|.:|:||:..|.||  :.:|....|.|.|:|.::
Mouse   231 YGKKFHVNYTQPLVAVKFLNVTPNVEVNVECRINAANIATDDERDKFAGRVAFKLRIN 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nrv3NP_001260675.1 Na_K-ATPase 20..307 CDD:395224 88/310 (28%)
Atp1b2NP_038201.1 Na_K_ATPase_bet 2..289 CDD:273446 91/318 (29%)
immunoglobulin-like. /evidence=ECO:0000250 193..290 33/104 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 135 1.000 Domainoid score I4946
eggNOG 1 0.900 - - E1_KOG3927
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 135 1.000 Inparanoid score I4549
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG45736
OrthoDB 1 1.010 - - D422722at33208
OrthoFinder 1 1.000 - - FOG0000357
OrthoInspector 1 1.000 - - mtm8856
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11523
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4478
SonicParanoid 1 1.000 - - X254
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1313.010

Return to query results.
Submit another query.