DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nrv3 and atp1b4

DIOPT Version :9

Sequence 1:NP_001260675.1 Gene:nrv3 / 35408 FlyBaseID:FBgn0032946 Length:313 Species:Drosophila melanogaster
Sequence 2:XP_002931848.1 Gene:atp1b4 / 100490400 XenbaseID:XB-GENE-975977 Length:317 Species:Xenopus tropicalis


Alignment Length:316 Identity:84/316 - (26%)
Similarity:136/316 - (43%) Gaps:64/316 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 GKW-EGFKKFLWNSETSQCLGRTGSSWAKILLFYIIFYAALTGFFAAIFTVFYQTLDNEKPKW-- 78
            |:| :..|.|:||.|..:.|||...|||.|||||.:.|..|.|.||........|:....|.:  
 Frog    45 GEWIQDMKHFIWNPEKKEVLGRDKRSWALILLFYSVLYCFLAGMFALCMYGLLATISPYVPTYRE 109

  Fly    79 -MLDNGLIGSNPGLGFRPMPPEANVESTLVWYESSKKDNYKYWVDETSRFLKYHTYQD-LEKQNQ 141
             :..       |||..|   |:||  :....:.||::..:..:.:..:.||:  .|.| .:|:..
 Frog   110 RVFP-------PGLTIR---PQAN--ALYFAFNSSERSTWSSYAESLNTFLE--DYNDETQKEKN 160

  Fly   142 VNCS----FEHPPQDD---KVCGIDFSSFSPCTA--DNNFGYHVARPCIFLKLNKIYNWIPEIYN 197
            :.|:    |..|.:|.   |.|....|....|:.  |.:||:...:|||.:|:|:|..     |.
 Frog   161 LVCTPGKYFLQPGEDHEERKACQFSRSLLRNCSGIEDPSFGFAQGKPCILIKMNRILG-----YQ 220

  Fly   198 DSKTLPDHMPEELKQHIKEKQSLRPNETNVVWVSCEGENPADVENIKARDYYPRMGFPRYYFPF- 261
            ....:|                        ::|:|| ...||:..:....:||...|...|:|: 
 Frog   221 AGSGIP------------------------IYVTCE-VLKADMSYLGPISFYPSDKFDLMYYPYY 260

  Fly   262 --KNIQGYIPPIVAVQFT-VETGVLINIECKAWARNI--NHDRSDRRGSVHFELMV 312
              .....|..|::|:||| |:....:|::||...::|  :|::....|.|.|.|.:
 Frog   261 GKLTHVNYTSPLIAMQFTGVKRNEDVNVQCKINGKDIISDHEKDRFLGRVAFTLHI 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nrv3NP_001260675.1 Na_K-ATPase 20..307 CDD:395224 79/305 (26%)
atp1b4XP_002931848.1 Na_K-ATPase 49..310 CDD:366001 79/304 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 124 1.000 Domainoid score I5426
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 124 1.000 Inparanoid score I4563
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D422722at33208
OrthoFinder 1 1.000 - - FOG0000357
OrthoInspector 1 1.000 - - mtm9519
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X254
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.060

Return to query results.
Submit another query.