DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp39D and CD63

DIOPT Version :9

Sequence 1:NP_523612.3 Gene:Tsp39D / 35405 FlyBaseID:FBgn0032943 Length:235 Species:Drosophila melanogaster
Sequence 2:NP_001244318.1 Gene:CD63 / 967 HGNCID:1692 Length:238 Species:Homo sapiens


Alignment Length:234 Identity:66/234 - (28%)
Similarity:117/234 - (50%) Gaps:6/234 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 GGLTCVKYLTFFCNLLF--ALTGLLIFLVGGMVQLNYAHYSNFVSDHVWTAPIILMIVGAAVAVI 66
            ||:.|||:|.:...|.|  ...||:...||..:.|:...........:  .|::::.||..:.::
Human     5 GGMKCVKFLLYVLLLAFCACAVGLIAVGVGAQLVLSQTIIQGATPGSL--LPVVIIAVGVFLFLV 67

  Fly    67 CFLGCCGALKESSCMILSFALLAVVIFLFEIGLGLAGYVKHTGLHQIMESQFNSTMQHYKERADY 131
            .|:|||||.||:.|::::||:...:|.|.|:...:||||....:.....:.|...|::|.:....
Human    68 AFVGCCGACKENYCLMITFAIFLSLIMLVEVAAAIAGYVFRDKVMSEFNNNFRQQMENYPKNNHT 132

  Fly   132 RDAWTLLQTELDCCGINGPNDWETV--YRNSTLPAACCSVINLSEAKECTNTHATQHGCLQKLLE 194
            ......:|.:..|||.....|||.:  ...:.:|.:||..:.:............:.||::|:..
Human   133 ASILDRMQADFKCCGAANYTDWEKIPSMSKNRVPDSCCINVTVGCGINFNEKAIHKEGCVEKIGG 197

  Fly   195 ILDSKTLILASVVLGVAGIQMLTILFACCLYRSFRRSYD 233
            .|....|::|:..||:|.:::|.|:|||||.:|.|..|:
Human   198 WLRKNVLVVAAAALGIAFVEVLGIVFACCLVKSIRSGYE 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp39DNP_523612.3 Tetraspannin 8..227 CDD:278750 61/222 (27%)
tetraspanin_LEL 104..200 CDD:239401 19/97 (20%)
CD63NP_001244318.1 Tetraspannin 10..227 CDD:395265 58/218 (27%)
CD63_LEL 105..203 CDD:239419 19/97 (20%)
Lysosomal targeting motif. /evidence=ECO:0000250|UniProtKB:P41731 234..238 1/3 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1467737at2759
OrthoFinder 1 1.000 - - FOG0005733
OrthoInspector 1 1.000 - - mtm8510
orthoMCL 1 0.900 - - OOG6_106877
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4418
SonicParanoid 1 1.000 - - X3621
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
98.750

Return to query results.
Submit another query.