DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp39D and TOM2A

DIOPT Version :10

Sequence 1:NP_523612.3 Gene:Tsp39D / 35405 FlyBaseID:FBgn0032943 Length:235 Species:Drosophila melanogaster
Sequence 2:NP_564399.1 Gene:TOM2A / 840133 AraportID:AT1G32400 Length:280 Species:Arabidopsis thaliana


Alignment Length:142 Identity:32/142 - (22%)
Similarity:52/142 - (36%) Gaps:47/142 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MASGGLTCVKYLTFFCNLLFALTGLLIFLVGGMVQLN---YAHYSNFVSDHV------------- 49
            ||..|  |::.|....|.|.|:.||      ||:...   :..|.....:.|             
plant     1 MACRG--CLECLLKLLNFLLAVAGL------GMIGYGIYLFVEYKRVTDNSVTFDLTNGDQSYVS 57

  Fly    50 WTAPIILMI---------------------VGAAVAVICFLGCCGALKESSCMILSFALLAVVIF 93
            :..||::.:                     :|.|:.||...||.|....|.|.:..::||.:::.
plant    58 FGRPILMAVSLSSNIFDNLPKAWFIYLFIGIGVALFVISCCGCVGTCSRSVCCLSCYSLLLILLI 122

  Fly    94 LFEIGLGLAGYV 105
            |.|  ||.|.::
plant   123 LVE--LGFAAFI 132

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp39DNP_523612.3 Tetraspanin 9..226 CDD:459767 28/134 (21%)
tetraspanin_LEL 131..>167 CDD:351888
TOM2ANP_564399.1 Tetraspanin 19..173 CDD:459767 25/122 (20%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.