DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp39D and cd63l

DIOPT Version :9

Sequence 1:NP_523612.3 Gene:Tsp39D / 35405 FlyBaseID:FBgn0032943 Length:235 Species:Drosophila melanogaster
Sequence 2:NP_001037906.1 Gene:cd63l / 733515 XenbaseID:XB-GENE-22164536 Length:244 Species:Xenopus tropicalis


Alignment Length:233 Identity:60/233 - (25%)
Similarity:105/233 - (45%) Gaps:7/233 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LTCVKYLTFFCNLLFALTGLLIFLVGGMVQLNYAHYSNFVSDHVWTAPIILMIVGAAVAVICFLG 70
            |.|:|....|..|||.:||:.:..:|..|||.....|..:|:....||::|.:.|..:.::...|
 Frog    10 LLCLKAGLLFIILLFWVTGVALICLGATVQLRLTDISVVLSETSSGAPLVLTVTGIIIFIMSGFG 74

  Fly    71 CCGALKESSCMILSFALLAVVIFLFEIGLGLAGYVKHTGLHQIMESQFNSTMQHYKERADYRDAW 135
            ....|||::.:|.:|..:.||||:.||.:|::.|.....|...:..:|...:..|........:.
 Frog    75 AISVLKENNMLIKTFIGIMVVIFIIEIIVGISAYSYREKLQSDISRRFQQILSKYGIDGQLTRSL 139

  Fly   136 TLLQTELDCCGINGPNDWETV---YRNSTLPAACCSVINLSEAKECTNTHATQ---HGCLQKLLE 194
            ...|.|..|||.....||..|   ...|::|.:||..:. .:..|....|...   .||:.|:..
 Frog   140 DYAQQEFRCCGAQNFTDWMNVTVTLLPSSVPKSCCRKVT-PKCGEKVMAHQDNIFLEGCVIKMKT 203

  Fly   195 ILDSKTLILASVVLGVAGIQMLTILFACCLYRSFRRSY 232
            .:.....::.:|.:|:..:|:..||.:..|.:..:.:|
 Frog   204 WISQHIDVIGAVGVGLGFVQLFGILLSFLLVKILQENY 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp39DNP_523612.3 Tetraspannin 8..227 CDD:278750 58/224 (26%)
tetraspanin_LEL 104..200 CDD:239401 21/101 (21%)
cd63lNP_001037906.1 Tetraspannin 13..233 CDD:366035 56/220 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 143 1.000 Domainoid score I4614
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 156 1.000 Inparanoid score I4185
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1467737at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3621
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.060

Return to query results.
Submit another query.