DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp39D and TSPAN6

DIOPT Version :9

Sequence 1:NP_523612.3 Gene:Tsp39D / 35405 FlyBaseID:FBgn0032943 Length:235 Species:Drosophila melanogaster
Sequence 2:NP_003261.1 Gene:TSPAN6 / 7105 HGNCID:11858 Length:245 Species:Homo sapiens


Alignment Length:229 Identity:55/229 - (24%)
Similarity:108/229 - (47%) Gaps:13/229 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LTCVKYLTFFCNLLFALTGLLIFLVGGMVQLNYAHYSNFVSDHVWTAPIILMIVGAAVAVICFLG 70
            :||.|.:......:|.:||:::..||...:::..:|.:.:::.....|.:|:..|..:.::...|
Human    14 ITCFKSVLLIYTFIFWITGVILLAVGIWGKVSLENYFSLLNEKATNVPFVLIATGTVIILLGTFG 78

  Fly    71 CCGALKESSCMILSFALLAVVIFLFEIGLGLAGYVKHTGLHQIMESQFNSTMQHYKERADYRD-A 134
            |....:.|:.|:..:|:...::||.|:...:.|:|....:....::.:...::.|....|||. |
Human    79 CFATCRASAWMLKLYAMFLTLVFLVELVAAIVGFVFRHEIKNSFKNNYEKALKQYNSTGDYRSHA 143

  Fly   135 WTLLQTELDCCGINGPNDW--ETVYRNSTLPAACCSVINLSEAKECTNTH----ATQHGCLQKLL 193
            ...:|..|.|||:....||  ...|.....|.:||.:      ::||...    ....||..|::
Human   144 VDKIQNTLHCCGVTDYRDWTDTNYYSEKGFPKSCCKL------EDCTPQRDADKVNNEGCFIKVM 202

  Fly   194 EILDSKTLILASVVLGVAGIQMLTILFACCLYRS 227
            .|::|:..::|.:..|||..|::.|..|.||.|:
Human   203 TIIESEMGVVAGISFGVACFQLIGIFLAYCLSRA 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp39DNP_523612.3 Tetraspannin 8..227 CDD:278750 53/225 (24%)
tetraspanin_LEL 104..200 CDD:239401 24/102 (24%)
TSPAN6NP_003261.1 Tetraspannin 17..236 CDD:306775 52/224 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8510
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
43.770

Return to query results.
Submit another query.