DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp39D and Tspan1

DIOPT Version :9

Sequence 1:NP_523612.3 Gene:Tsp39D / 35405 FlyBaseID:FBgn0032943 Length:235 Species:Drosophila melanogaster
Sequence 2:NP_598442.1 Gene:Tspan1 / 66805 MGIID:1914055 Length:240 Species:Mus musculus


Alignment Length:236 Identity:59/236 - (25%)
Similarity:102/236 - (43%) Gaps:25/236 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 VKYLTFFCNLLFALTGLLIFLVGGMVQLN-------YAHYSNFVSDHVWTAPIILMIVGAAVAVI 66
            :|.:.|..|||..|.|..:..||..|.::       :...|:.....| .....|:..||.:.::
Mouse     7 IKVMMFLFNLLIFLCGAALLAVGIWVSVDGTSFLKVFGSLSSSAMQFV-NVGYFLIAAGAVLFIL 70

  Fly    67 CFLGCCGALKESSCMILSFALLAVVIFLFEIGLGLAGYVKHTGLHQIMESQFNSTM------QHY 125
            .||||.||..|:.|:::.|..:.::||:.||...:...|..|     :..||.:.:      :.|
Mouse    71 GFLGCYGAHSENKCVLMMFFSILLIIFIAEIAGAVVALVYTT-----LAEQFLTLLVVPAIEKDY 130

  Fly   126 KERADYRDAWTLLQTELDCCGINGPNDWET---VYRNSTLPAACCSVINLSEAKECTNTHATQ-- 185
            ..:.|:...|.....||.|||.|...|:..   |..|...|..||:.......:.||...|..  
Mouse   131 GYQTDFTQVWNTTMEELHCCGFNNYTDFNASRFVKENKVFPPPCCANPGNHTVEPCTEEKAKSMK 195

  Fly   186 -HGCLQKLLEILDSKTLILASVVLGVAGIQMLTILFACCLY 225
             .||.:::|..:.:..:.:..|.:|||.:::..::.:..||
Mouse   196 VQGCFKEILHRIRANAVTVGGVAVGVAALELAAMVVSMYLY 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp39DNP_523612.3 Tetraspannin 8..227 CDD:278750 59/236 (25%)
tetraspanin_LEL 104..200 CDD:239401 25/107 (23%)
Tspan1NP_598442.1 Tetraspannin 7..235 CDD:366035 57/233 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.