DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp39D and Tspan4

DIOPT Version :9

Sequence 1:NP_523612.3 Gene:Tsp39D / 35405 FlyBaseID:FBgn0032943 Length:235 Species:Drosophila melanogaster
Sequence 2:XP_030098725.1 Gene:Tspan4 / 64540 MGIID:1928097 Length:333 Species:Mus musculus


Alignment Length:235 Identity:70/235 - (29%)
Similarity:113/235 - (48%) Gaps:18/235 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MASGGLTCVKYLTFFCNLLFALTGLLIFLVG---GMVQLNYAHY-SNFVSDHVWTAPIILMIVGA 61
            ||.|.|..||||.|..||||.|.|..:..||   ...|.|:|.. |:|.|   .:|..:|::.|.
Mouse    96 MARGCLQGVKYLMFAFNLLFWLGGCGVLGVGIWLAATQGNFATLSSSFPS---LSAANLLIVTGT 157

  Fly    62 AVAVICFLGCCGALKESSCMILSFALLAVVIFLFEIGLGLAGYVKHTGLHQIMESQFNSTMQHYK 126
            .|..|.|:||.|||||:.|::|:|.:|.:::||.|..:.:..:.....:....:......:..|.
Mouse   158 FVMAIGFVGCIGALKENKCLLLTFFVLLLLVFLLEATIAVLFFAYSDKIDSYAQQDLKKGLHLYG 222

  Fly   127 ERAD--YRDAWTLLQTELDCCGINGPNDWETVYRNSTLPAACCSVINLSEAKECTNTHAT----Q 185
            .:.:  ..:||:::||:..|||::...||..||..:.:|.:||     .|..:....|..    :
Mouse   223 TQGNVGLTNAWSIIQTDFRCCGVSNYTDWFEVYNATRVPDSCC-----LEFSDSCGLHEPGTWWK 282

  Fly   186 HGCLQKLLEILDSKTLILASVVLGVAGIQMLTILFACCLY 225
            ..|.:.:...|....|.:....|..|.:|:|.:.||..:|
Mouse   283 SPCYETVKAWLQENLLAVGIFGLCTALVQILGLTFAMTMY 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp39DNP_523612.3 Tetraspannin 8..227 CDD:278750 66/228 (29%)
tetraspanin_LEL 104..200 CDD:239401 19/101 (19%)
Tspan4XP_030098725.1 Tetraspannin 104..321 CDD:366035 65/224 (29%)
NET-5_like_LEL 200..297 CDD:239418 19/101 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.