DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp39D and Tspan6

DIOPT Version :9

Sequence 1:NP_523612.3 Gene:Tsp39D / 35405 FlyBaseID:FBgn0032943 Length:235 Species:Drosophila melanogaster
Sequence 2:NP_062630.2 Gene:Tspan6 / 56496 MGIID:1926264 Length:245 Species:Mus musculus


Alignment Length:225 Identity:54/225 - (24%)
Similarity:113/225 - (50%) Gaps:5/225 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LTCVKYLTFFCNLLFALTGLLIFLVGGMVQLNYAHYSNFVSDHVWTAPIILMIVGAAVAVICFLG 70
            :||:|.:......:|.:||:::..||...:::..:|.:.:::.....|.:|:..|..:.::...|
Mouse    14 ITCLKSVLLIYTFIFWITGVILLAVGIWGKVSLENYFSLLNEKATNVPFVLIGTGTVIILLGTFG 78

  Fly    71 CCGALKESSCMILSFALLAVVIFLFEIGLGLAGYVKHTGLHQIMESQFNSTMQHYKERADYR-DA 134
            |....:.|:.|:..:|:...:|||.|:...:.|:|....:....:|.:.:.::.|....||| :|
Mouse    79 CFATCRASAWMLKLYAMFLTLIFLVELVAAIVGFVFRHEIKNSFKSNYENALKEYNSTGDYRSEA 143

  Fly   135 WTLLQTELDCCGINGPNDWE--TVYRNSTLPAACCSVINLSEAKECTNTHATQHGCLQKLLEILD 197
            ...:|:.|.|||:....||:  ..|..:..|.:||.:......::....:  :.||..|::..::
Mouse   144 VDKIQSTLHCCGVTNYGDWKGTNYYSETGFPKSCCKLEGCYPQRDADKVN--EEGCFIKVMTTIE 206

  Fly   198 SKTLILASVVLGVAGIQMLTILFACCLYRS 227
            |:..::|.:..|||..|::.|..|.||.|:
Mouse   207 SEMGVVAGISFGVACFQLIGIFLAYCLSRA 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp39DNP_523612.3 Tetraspannin 8..227 CDD:278750 52/221 (24%)
tetraspanin_LEL 104..200 CDD:239401 22/98 (22%)
Tspan6NP_062630.2 Tetraspannin 17..233 CDD:366035 49/217 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.770

Return to query results.
Submit another query.