DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp39D and TSPAN11

DIOPT Version :9

Sequence 1:NP_523612.3 Gene:Tsp39D / 35405 FlyBaseID:FBgn0032943 Length:235 Species:Drosophila melanogaster
Sequence 2:XP_011518981.1 Gene:TSPAN11 / 441631 HGNCID:30795 Length:302 Species:Homo sapiens


Alignment Length:222 Identity:62/222 - (27%)
Similarity:106/222 - (47%) Gaps:17/222 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 VKYLTFFCNLLFALTGLLIFLVGGMVQLNYAHYSNFVSDHVWTA-PIILMIVGAAVAVICFLGCC 72
            :|||.|..|..|.:.|..:..||....:..:.|.:.::...:.| ..||:..|..|.|..||| .
Human    16 LKYLLFVFNFFFWVGGAAVLAVGIWTLVEKSGYLSVLASSTFAASAYILIFAGVLVMVTGFLG-F 79

  Fly    73 GAL--KESSCMILSFALLAVVIFLFEIGLGLAGYVKHTGLHQIMESQFNSTM-QHYKERADYRDA 134
            ||:  :...|:...|.|| :||||.|:..|:..:|.:..|...::...|.|: ::|.:....:..
Human    80 GAILWERKGCLSTYFCLL-LVIFLVELVAGVLAHVYYQRLSDELKQHLNRTLAENYGQPGATQIT 143

  Fly   135 WTL--LQTELDCCGINGPNDWE-TVY------RNSTLPAACCS--VINLSEAKECTNTHATQHGC 188
            .::  ||.:..|||.|...||: :.|      ....:|.:||.  |:...:....:|.:..:.||
Human   144 ASVDRLQQDFKCCGSNSSADWQHSTYILLREAEGRQVPDSCCKTVVVRCGQRAHPSNIYKVEGGC 208

  Fly   189 LQKLLEILDSKTLILASVVLGVAGIQM 215
            |.||.:.|....|::.:|.:|||.:|:
Human   209 LTKLEQFLADHLLLMGAVGIGVACLQI 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp39DNP_523612.3 Tetraspannin 8..227 CDD:278750 62/222 (28%)
tetraspanin_LEL 104..200 CDD:239401 25/107 (23%)
TSPAN11XP_011518981.1 Tetraspannin 16..235 CDD:278750 61/220 (28%)
PHA03242 <50..>118 CDD:177566 22/69 (32%)
CD151_like_LEL 112..220 CDD:239408 25/107 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4418
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.