DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp39D and Tsp96F

DIOPT Version :9

Sequence 1:NP_523612.3 Gene:Tsp39D / 35405 FlyBaseID:FBgn0032943 Length:235 Species:Drosophila melanogaster
Sequence 2:NP_001262976.1 Gene:Tsp96F / 43127 FlyBaseID:FBgn0027865 Length:284 Species:Drosophila melanogaster


Alignment Length:276 Identity:74/276 - (26%)
Similarity:119/276 - (43%) Gaps:67/276 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SGGLTCVKYLTFFCNLLFALTGLLIFLVG-----------GMVQLNYAHYSNFVSDHVWTAPIIL 56
            :|..:|||||....|:||.|.||.|.:..           .|.| ||.||      |:  |..:.
  Fly     4 NGCCSCVKYLMVLINILFWLIGLTIVVTSVWMLTDPTFMLSMTQ-NYNHY------HI--ALYVF 59

  Fly    57 MIVGAAVAVICFLGCCGALKESSCMILSFALLAVVIFLFEIGLGLAGYVKHTGLHQIMESQFNST 121
            :.:|..:.:..|.||||..:||.|:::||..:.:::.:.:|..|...:.....|..|:.:...|:
  Fly    60 LAIGILITLGAFFGCCGVCRESQCLLVSFFCVILIVMVAQIAAGAWAFHNKDKLDDIVRAAVKSS 124

  Fly   122 MQHYKERADYRDA--------WTLLQTELDCCGINGPNDWETVYRNS------------------ 160
            :|.     :|..:        :..||..|.|||.:||.||.|...|:                  
  Fly   125 VQE-----EYGQSTMSSRTVTFDTLQKNLKCCGADGPGDWATSRFNNVDRTNIVEIAVSSMNVFY 184

  Fly   161 TLPAACCSVINLSEAKEC-----------TNTHATQHGCLQKLLEILDSKTLILASVVLGVAGIQ 214
            .:|.:||. .||.: .||           .|....|.||:.||:||:....:.:.:|...|..::
  Fly   185 NIPESCCK-DNLKD-NECELSRRLKFGGPLNNAIYQQGCVDKLIEIIYENWVTIFAVTAAVILLE 247

  Fly   215 MLTILFA---CCLYRS 227
            :|::.||   ||..|:
  Fly   248 LLSLTFALSLCCAVRN 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp39DNP_523612.3 Tetraspannin 8..227 CDD:278750 72/269 (27%)
tetraspanin_LEL 104..200 CDD:239401 32/132 (24%)
Tsp96FNP_001262976.1 Tetraspannin 9..261 CDD:278750 72/267 (27%)
CD151_like_LEL 107..233 CDD:239408 32/132 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.