DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp39D and Tsp66E

DIOPT Version :9

Sequence 1:NP_523612.3 Gene:Tsp39D / 35405 FlyBaseID:FBgn0032943 Length:235 Species:Drosophila melanogaster
Sequence 2:NP_523985.1 Gene:Tsp66E / 39017 FlyBaseID:FBgn0035936 Length:267 Species:Drosophila melanogaster


Alignment Length:261 Identity:62/261 - (23%)
Similarity:121/261 - (46%) Gaps:34/261 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 GLTCVKYLTFFCNLLFALTGLLIFLVGGMVQLN----YAHYSNFVSDHV--WTAP-------IIL 56
            |:.|.|||....|.:|.:.|.:||.||..:.::    .|......|:.:  :|.|       .:|
  Fly     6 GVWCAKYLLCIFNFIFFVLGTIIFGVGLWLAVDKHSLIALLKLVESERIEQFTQPQAIEQLAYVL 70

  Fly    57 MIVGAAVAVICFLGCCGALKESSCMILSFALLAVVIFLFEIGLGLAGYVKHTGLHQIMESQFNST 121
            :::||.:..:.|||..||::||.|::.::....:::.:.||..|..|......:....::...:|
  Fly    71 LVIGAVMFFMSFLGYLGAMRESRCLLSTYGTFLILLLIAEIVAGGLGAFFKDKVRAESKNFLQTT 135

  Fly   122 MQHYK--ERADYRD-AWTLLQTELDCCGINGPND------WETVYRNSTLPAACCSVINLSEA-- 175
            :..|.  |..|... .|..|.....|||||..:|      |.....|.|:|.|||.:.::::.  
  Fly   136 ITSYSLGENVDATSLMWNQLMGNFGCCGINDYHDFDASPAWVNGKGNRTIPDACCILKDVAKLVP 200

  Fly   176 --KECTNTHATQH-----GCLQKLLE-ILDSKTLILASVVLGVAGIQMLTILFACCLYRSFRRSY 232
              ::||...:..:     ||.:...| ::..:.|::.::.:|:..:.::.:.||.|  ::|.:..
  Fly   201 RDEDCTTNPSDSNSFYKKGCYEVFTEWLIRQRELVIVAIAVGIVHLVLIILAFALC--KAFAKYN 263

  Fly   233 D 233
            |
  Fly   264 D 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp39DNP_523612.3 Tetraspannin 8..227 CDD:278750 59/250 (24%)
tetraspanin_LEL 104..200 CDD:239401 24/114 (21%)
Tsp66ENP_523985.1 Tetraspannin 9..258 CDD:278750 59/250 (24%)
uroplakin_I_like_LEL 116..231 CDD:239409 25/114 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.