DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp39D and Tsp42Ep

DIOPT Version :9

Sequence 1:NP_523612.3 Gene:Tsp39D / 35405 FlyBaseID:FBgn0032943 Length:235 Species:Drosophila melanogaster
Sequence 2:NP_001260759.1 Gene:Tsp42Ep / 35626 FlyBaseID:FBgn0033137 Length:250 Species:Drosophila melanogaster


Alignment Length:253 Identity:57/253 - (22%)
Similarity:101/253 - (39%) Gaps:61/253 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SGGLTCVKYLTFFCNLLFALTGLLIFLVGG----MVQLNYAHYSNFVSDHVWTAPIILMIVGAAV 63
            :|....:||.....|||:.|.|:.:....|    |.:.|...::.||..         :::|.::
  Fly     2 NGCYNTIKYTGLLSNLLYMLLGIGVMSGAGLGLQMAEPNTPEHTYFVKS---------LVLGGSI 57

  Fly    64 AVICFLGCCGALKESSCMILSFALLAVVIFLFEIGLGLAGYVKHT-------GLHQIMESQFNS- 120
            .:|...||.|.:....|:.|.|.:..::....|. |.|..|  |:       |..|.:|..::. 
  Fly    58 CMIVMFGCYGMVANLLCVNLIFTMFILIALAAEY-LQLHHY--HSPSLRSPGGAWQQLELAWHGL 119

  Fly   121 ----TMQHYKERADYRDAWTLLQTELDCCGINGPNDWETVYRNSTLPAACCSVINLSEAKECTNT 181
                .:.|..|.:.:            |||.||.:|::.::  ..:||:|        .:...|.
  Fly   120 DRDPELMHQYEASQH------------CCGYNGADDYKRLH--LLVPASC--------YQAAVND 162

  Fly   182 HATQ---HGCL------QKLLEILDSKTLILASVVLGVAGIQMLTILFACCLYRSFRR 230
            .|.|   .|||      |:.::..| |..:.|.|.|.:. |.:.|:..:..|:|..:|
  Fly   163 TAQQIYPSGCLETLNRSQRYIQHRD-KLYMWAIVGLEIF-ILLQTVALSVLLFRLRQR 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp39DNP_523612.3 Tetraspannin 8..227 CDD:278750 54/243 (22%)
tetraspanin_LEL 104..200 CDD:239401 24/116 (21%)
Tsp42EpNP_001260759.1 Tetraspannin <51..213 CDD:278750 41/188 (22%)
tetraspanin_LEL 91..183 CDD:239401 25/116 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.