DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp39D and Tsp42El

DIOPT Version :9

Sequence 1:NP_523612.3 Gene:Tsp39D / 35405 FlyBaseID:FBgn0032943 Length:235 Species:Drosophila melanogaster
Sequence 2:NP_523638.1 Gene:Tsp42El / 35622 FlyBaseID:FBgn0033134 Length:217 Species:Drosophila melanogaster


Alignment Length:249 Identity:65/249 - (26%)
Similarity:108/249 - (43%) Gaps:62/249 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 VKYLTFFCNLLFALTGLLIFLVGGMVQLNYAHYSNFVSDHVWTA-----PIILMIVGAAVAVICF 68
            :||..|..|.|:|:.|:|:.:.||:               .|.|     .|.::|:|..:.||..
  Fly     8 IKYSLFLFNALWAILGILVLIFGGL---------------GWGAMPDAYAIGILILGGTILVISL 57

  Fly    69 LGCCGALKESSCMILSFALLAVVIFLFEIG---LGLAGYVKHTGLHQIMESQFNSTMQHYKERAD 130
            .|||||::||..|:.::|.|.:::.|..:.   |......|...| |.:|:|             
  Fly    58 FGCCGAVRESPRMLWTYASLLLILLLLIVAFIILNPKDVFKKYAL-QTVENQ------------- 108

  Fly   131 YRDAWTLLQTE---LD-------CCGINGPNDW-ETVYRNSTLPAACCSVINLSEAKECTN-THA 183
                |.|.||:   :|       |||.:...|: :..:.|:|:|::||      :...|.| .:.
  Fly   109 ----WELEQTKPGSMDIIQKTYYCCGRDSAQDYLDIKFWNNTVPSSCC------KDDSCVNPLNL 163

  Fly   184 TQHGCLQKLLEILDSKTLILASVVLGVAGIQMLTILFACCL---YRSFRRSYDH 234
            ...|||.|:.|....:...|..:..|:.|...:.:|.|..|   |.:.||.|::
  Fly   164 YVRGCLIKVEEAFADEATTLGYLEWGLLGFNAVILLLAIILAIHYTNRRRRYNY 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp39DNP_523612.3 Tetraspannin 8..227 CDD:278750 62/240 (26%)
tetraspanin_LEL 104..200 CDD:239401 26/107 (24%)
Tsp42ElNP_523638.1 Tetraspannin 7..196 CDD:278750 58/226 (26%)
tetraspanin_LEL 94..178 CDD:239401 26/107 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.