DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp39D and Tsp33B

DIOPT Version :9

Sequence 1:NP_523612.3 Gene:Tsp39D / 35405 FlyBaseID:FBgn0032943 Length:235 Species:Drosophila melanogaster
Sequence 2:NP_523552.1 Gene:Tsp33B / 34590 FlyBaseID:FBgn0032376 Length:326 Species:Drosophila melanogaster


Alignment Length:251 Identity:56/251 - (22%)
Similarity:90/251 - (35%) Gaps:60/251 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 ALTGLLIFLVGGMVQLNYAH--YSNFVSD----HVWTAPIILMIVGAAVAV--ICFLGCCGALKE 77
            |:.||||.:|..     |.|  .:.::||    .|:.....:.:.||.|.|  :|.:.....:..
  Fly    20 AVIGLLILVVTA-----YYHTVLTGYLSDIECRLVYGYLFGIYVFGAQVVVTFLCSIAMWRRIWR 79

  Fly    78 SSC-----MILS-FALLAVVIFLFEIGLGLAGYVKHTGLHQIMESQFNSTMQHYKERADYRDAWT 136
            ..|     ::|| :|..:.||.....|.....|.....|....::.....:..|....:::..|.
  Fly    80 RRCTPNIRLLLSVWAFYSCVIIASGFGCVWNLYRGVDVLENAADTSLTRGIDMYYSCPEWKLLWD 144

  Fly   137 LLQTELDCCGINGPNDW---ETVYR---NST----LPAACCSVINLSEAKECTNT---------- 181
            .||...:|||::|..||   |.:.|   |.|    .|.|||.    .....|.|.          
  Fly   145 GLQWHKECCGVHGYKDWMNAEWMPRRENNCTSMVLAPFACCK----RSCDSCFNNFLPSEGQSIG 205

  Fly   182 -------------HATQHGCLQKLLEILDSKTLILASVVLGVAGIQMLTILFACCL 224
                         ....:|||...:..:.:...||  :.|.|..::.|.:|  ||:
  Fly   206 GNSRQPFPALTVDSINANGCLPAFVSAVWNCFYIL--MALWVLALKFLIVL--CCM 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp39DNP_523612.3 Tetraspannin 8..227 CDD:278750 56/251 (22%)
tetraspanin_LEL 104..200 CDD:239401 25/128 (20%)
Tsp33BNP_523552.1 Tetraspannin 20..256 CDD:278750 54/248 (22%)
CD151_like_LEL 112..237 CDD:239408 25/128 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.