DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp39D and Tsp29Fb

DIOPT Version :9

Sequence 1:NP_523612.3 Gene:Tsp39D / 35405 FlyBaseID:FBgn0032943 Length:235 Species:Drosophila melanogaster
Sequence 2:NP_001137809.1 Gene:Tsp29Fb / 34212 FlyBaseID:FBgn0032075 Length:308 Species:Drosophila melanogaster


Alignment Length:243 Identity:65/243 - (26%)
Similarity:123/243 - (50%) Gaps:16/243 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SGGLTCVKYLTFFCNLLFALTGLLIFLVGGMVQLNYAHYSNFVSDHVWTAPIILMIVGAAVAVIC 67
            :.|:.|.||:....:.:||||.:|:.:||..:|..:..:|.|:..|..:.|.:|:.:|..:..:.
  Fly     9 NSGMKCAKYMLIIVSFMFALTAILLIMVGTTIQTIFGDFSLFIDGHFSSPPALLIAIGFILIAVA 73

  Fly    68 FLGCCGALKESSCMILSFALLAVVIFLFEIGLGLAGYVKHTGLHQIMESQFNSTMQHYKERADYR 132
            .||..||:|||..:|..:.:...::|:.|:...:|.:|..:.:..::....|..:..|:......
  Fly    74 ALGAYGAVKESVMVINLYGVCLFLVFILEVSAAIAAFVMQSQVRGMLIRTMNQALAEYEHDPYVE 138

  Fly   133 DAWTLLQTELDCCGINGPNDWE---TVYRNSTL-------PAACC----SVINLSEAKECTNTHA 183
            .....:|:.|:|||:|.|.||:   :...|.||       |.:||    :.:|.|....|..|: 
  Fly   139 SGVDFMQSMLECCGVNEPEDWKDYLSANVNFTLGVDDVVVPNSCCGNQPTSLNDSTQMTCMETY- 202

  Fly   184 TQHGCLQKLLEILDSKTLILASVVLGVAGIQMLTILFACCLYRSFRRS 231
             .:||.:|:..|:....:::|:....||.:|:|.:|.|..|.::.||:
  Fly   203 -DYGCFRKMNFIVSQSAMLIATGATTVAFVQLLGVLCAFMLAKTLRRN 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp39DNP_523612.3 Tetraspannin 8..227 CDD:278750 62/232 (27%)
tetraspanin_LEL 104..200 CDD:239401 26/109 (24%)
Tsp29FbNP_001137809.1 Tetraspannin 14..246 CDD:278750 62/233 (27%)
tetraspanin_LEL 110..218 CDD:239401 26/109 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D130922at50557
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm43294
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.