DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp39D and Tsp29Fa

DIOPT Version :9

Sequence 1:NP_523612.3 Gene:Tsp39D / 35405 FlyBaseID:FBgn0032943 Length:235 Species:Drosophila melanogaster
Sequence 2:NP_001162915.1 Gene:Tsp29Fa / 34211 FlyBaseID:FBgn0032074 Length:248 Species:Drosophila melanogaster


Alignment Length:238 Identity:71/238 - (29%)
Similarity:125/238 - (52%) Gaps:10/238 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MASGGLTCVKYLTFFCNLLFALTGLLIFLVGGMVQLNYAHYSNFVSDHVWTAPIILMIVGAAVAV 65
            :.:|....|||..|..||:|.:||:::..||..|...|..|..|::...::.|..|:::|:.:.:
  Fly     3 LLTGSANAVKYTLFGFNLIFLITGIILIAVGAGVGAVYTGYKLFLAGKFFSIPTFLIVIGSFIII 67

  Fly    66 ICFLGCCGALKESSCMILSFALLAVVIFLFEIGLGLAGYVKHTGLHQIMESQFNSTMQHYKE--- 127
            |.|.||.|||||:.|::|||:::..:||:.|:..|::|||.......::::....::..|..   
  Fly    68 ISFFGCWGALKENYCLVLSFSVMLAIIFILELAAGISGYVLRNDASDLIKTSLTYSLNEYNSINP 132

  Fly   128 RADYRDAWTLLQTELDCCGINGPNDWETVYRNSTLPAACCSV-INLSEAKECTNTH---ATQH-- 186
            .|..: .|..:|.|.:|||:...|||.|.:.|..||.:||:| :.......|.|..   |.:|  
  Fly   133 NATTK-LWDDIQDEFECCGVTSYNDWITAFPNGDLPISCCNVHVGAVGTFTCNNAQSSVADRHKV 196

  Fly   187 GCLQKLLEILDSKTLILASVVLGVAGIQMLTILFACCLYRSFR 229
            |||......:.:..:.|.:..:.:|.:|...::|||.:.|..:
  Fly   197 GCLDGFSGYISAHAVSLGAAGVVIAILQFFGVIFACYIAREIK 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp39DNP_523612.3 Tetraspannin 8..227 CDD:278750 69/227 (30%)
tetraspanin_LEL 104..200 CDD:239401 27/104 (26%)
Tsp29FaNP_001162915.1 Tetraspannin 11..238 CDD:278750 70/227 (31%)
tetraspanin_LEL 106..210 CDD:239401 27/104 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D130922at50557
OrthoFinder 1 1.000 - - FOG0005733
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_106877
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4418
SonicParanoid 1 1.000 - - X3621
87.850

Return to query results.
Submit another query.