DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp39D and cd63

DIOPT Version :9

Sequence 1:NP_523612.3 Gene:Tsp39D / 35405 FlyBaseID:FBgn0032943 Length:235 Species:Drosophila melanogaster
Sequence 2:NP_955837.1 Gene:cd63 / 321461 ZFINID:ZDB-GENE-030131-180 Length:237 Species:Danio rerio


Alignment Length:238 Identity:76/238 - (31%)
Similarity:130/238 - (54%) Gaps:15/238 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 GGLTCVKYLTFFCNLLFALTGLLIFLVGGMVQLNYAHYSNFVSDHVWTAPIILMIVGAAVAVICF 68
            ||..|||||.||.|.:|.|.||.:.::|.:|.::.  ::..:......:|::|::||..:..|.|
Zfish     5 GGAKCVKYLLFFFNFIFWLCGLALIVLGILVHVSL--HNTAILQGASGSPMVLIVVGVIIFFISF 67

  Fly    69 LGCCGALKESSCMILSFALLAVVIFLFEIGLGLAGYVKHTGLHQIMESQFNSTMQHYKERADYRD 133
            .|||||.||:.||:::||::..:|.:.|||.|:|||:....::::::..||:.:..|.:..:||.
Zfish    68 FGCCGAWKENQCMVVTFAIILSLIVITEIGAGIAGYIFRGKVNELLDQSFNTMIAGYNKTEEYRT 132

  Fly   134 AWTLLQTELDCCGINGPNDWETVYRNS-TLPAACCSVINLSEAKECTNTHATQ------HGCLQK 191
            ....:|.:|.|||.|..:||.....:. ::|.:||..:    .|.|.....|:      .|| |.
Zfish   133 TLDSIQKQLKCCGGNSSSDWVNFSADHISVPDSCCKNV----TKNCGIGAMTKPTVIYLEGC-QP 192

  Fly   192 LLEI-LDSKTLILASVVLGVAGIQMLTILFACCLYRSFRRSYD 233
            :||. :....|.:|...|.:..:|:..|:.||.|.|:.|..|:
Zfish   193 ILETRIKENILWIAVGALVIGFVQITGIVLACILSRAIRSGYE 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp39DNP_523612.3 Tetraspannin 8..227 CDD:278750 71/226 (31%)
tetraspanin_LEL 104..200 CDD:239401 25/103 (24%)
cd63NP_955837.1 Tetraspannin 9..230 CDD:278750 72/227 (32%)
CD63_LEL 103..202 CDD:239419 25/103 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1467737at2759
OrthoFinder 1 1.000 - - FOG0005733
OrthoInspector 1 1.000 - - otm40247
orthoMCL 1 0.900 - - OOG6_106877
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4418
SonicParanoid 1 1.000 - - X3621
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
109.710

Return to query results.
Submit another query.