DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp39D and Tsp5D

DIOPT Version :9

Sequence 1:NP_523612.3 Gene:Tsp39D / 35405 FlyBaseID:FBgn0032943 Length:235 Species:Drosophila melanogaster
Sequence 2:NP_001259266.1 Gene:Tsp5D / 31540 FlyBaseID:FBgn0029837 Length:287 Species:Drosophila melanogaster


Alignment Length:273 Identity:60/273 - (21%)
Similarity:117/273 - (42%) Gaps:40/273 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MASGGLTCVKYLTFFCNLLFALTGLLIFLVGGMVQLNYAHYSNFVSDHV-WTAPIILMIVGAAVA 64
            |.:.|.||::....:.|::..|........|..::|:||.|:..:..|. .:|..|.|.:|....
  Fly     1 MGNAGYTCIRRTFCWLNIILWLCSCAFLGAGLWLRLSYAGYATLLPQHAGLSADTIFMGIGGTGF 65

  Fly    65 VICFLGCCGALKESSCMILSFALLAVVIFLFEIGLGLAGYVKHTGLHQIMESQFNSTMQHYKERA 129
            |:.|.|||||..:|.|:::.:.:|.|::|:.|..:|...::...||.:.:.::....::.:...:
  Fly    66 VVSFFGCCGAWVQSRCLLVLYFMLIVMLFMSEFLVGSIAFLFRGGLGRTLANELRFGIERHYNSS 130

  Fly   130 D--------YRDAWTLLQTELDCCGINGPNDWETVYR---NSTLPAACCSVIN-----LSEAK-- 176
            |        ....|..:|...:|||::...||..:..   ...:|.:||..:.     |:|..  
  Fly   131 DRGSLVAPSVASIWDSVQQSFECCGVSSYEDWYDIQSWPGRRWVPESCCRTLYDQRQVLTEGSGD 195

  Fly   177 -----ECTNTHAT----QHGCLQKLLEILDSKTLILASVVLGVAGIQML----TILFACCL---- 224
                 :|..:...    ..||...|......:..::.:|.||:|.:|:.    ::|..|.:    
  Fly   196 GMMRPDCGRSENPSLWWDKGCAHSLQSWFTGQLNVVGAVGLGIAFVQLFGLITSMLLFCTVKHKR 260

  Fly   225 ----YRSFRRSYD 233
                |:|:..|.|
  Fly   261 ASDTYKSYSPSID 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp39DNP_523612.3 Tetraspannin 8..227 CDD:278750 54/258 (21%)
tetraspanin_LEL 104..200 CDD:239401 19/122 (16%)
Tsp5DNP_001259266.1 Tetraspannin 8..256 CDD:278750 53/247 (21%)
NET-5_like_LEL 105..228 CDD:239418 19/122 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.