DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp39D and Tspan9

DIOPT Version :9

Sequence 1:NP_523612.3 Gene:Tsp39D / 35405 FlyBaseID:FBgn0032943 Length:235 Species:Drosophila melanogaster
Sequence 2:NP_001101360.1 Gene:Tspan9 / 312728 RGDID:1304740 Length:330 Species:Rattus norvegicus


Alignment Length:252 Identity:75/252 - (29%)
Similarity:125/252 - (49%) Gaps:33/252 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MASGGLTCVKYLTFFCNLLFALTGLLIFLVG---GMVQLNYAHYS-NFVSDHVWTAPIILMIVGA 61
            ||.|.|.|:||:.|..||:|.|.|..:..||   .:.|.|:|.:| :|.|   .:|..:::.:|.
  Rat    92 MARGCLCCLKYMMFLFNLIFWLCGCGLLGVGIWLSVSQGNFATFSPSFPS---LSAANLVIAIGT 153

  Fly    62 AVAVICFLGCCGALKESSCMILSFALLAVVIFLFEIGLGLAGYVKHTGLHQIMESQFNSTMQHYK 126
            .|.|..||||.||:||:.|::|||.::.::|.|.|:.|.:..:|       .|:....:..|..|
  Rat   154 IVMVTGFLGCLGAIKENKCLLLSFFIVLLIILLAELILLILFFV-------YMDKVNENAKQDLK 211

  Fly   127 E---------RADYRDAWTLLQTELDCCGINGPNDWETVYRNSTLPAACCSVINLSEAKECTNTH 182
            |         ....::||.::|.|:.|||:....||..|...:|:|..||    :..::.|....
  Rat   212 EGLLLYNTENNVGLKNAWNIIQAEMRCCGVTDYTDWYPVLGENTVPDRCC----MENSQGCGRNS 272

  Fly   183 AT---QHGCLQKLLEILDSKTLILASVVLGVAGIQMLTILFACCLYRSFRRS---YD 233
            .|   :.||.:|:....|....:|.:|.:....:|:|.:.|:..|::...|:   ||
  Rat   273 TTPLWKTGCYEKVKLWFDDNKHVLGTVGMCFLIMQILGMAFSMTLFQHIHRTGKKYD 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp39DNP_523612.3 Tetraspannin 8..227 CDD:278750 68/234 (29%)
tetraspanin_LEL 104..200 CDD:239401 25/107 (23%)
Tspan9NP_001101360.1 Tetraspannin 100..317 CDD:395265 66/230 (29%)
NET-5_like_LEL 196..293 CDD:239418 25/107 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19282
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.