DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp39D and Tsp3A

DIOPT Version :9

Sequence 1:NP_523612.3 Gene:Tsp39D / 35405 FlyBaseID:FBgn0032943 Length:235 Species:Drosophila melanogaster
Sequence 2:NP_001245504.1 Gene:Tsp3A / 31244 FlyBaseID:FBgn0040334 Length:304 Species:Drosophila melanogaster


Alignment Length:254 Identity:63/254 - (24%)
Similarity:116/254 - (45%) Gaps:47/254 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 CVKYLTFFCNLLFALTGLLIFLVG------------GMVQLNYAHYSNFVSDHVWTAPIILMIVG 60
            ||||:.|..|.:|.|.|.|:..:|            |.|:|     .||. |......:::::.|
  Fly    42 CVKYMIFLLNFVFWLFGGLLLGIGVYAFRDKWEDANGSVRL-----ENFY-DVFLNISLVMILAG 100

  Fly    61 AAVAVICFLGCCGALKESSCMILSFALLAVVIFLFEIGLGLAGYVKHTGLHQIMESQFNSTMQH- 124
            ..:.::.|.||.|||:|::.::..:::..::.||.|:.:.:..:|....::..:|.||...:.| 
  Fly   101 TVIFLVSFSGCVGALRENTFLLKFYSMCLLLFFLLEMAIAIVCFVCPQYMNTFLEKQFTHKIIHS 165

  Fly   125 YKERADYRDAWTLLQTELDCCGI--NGPNDW-ETVYRNST--------LPAACC--------SVI 170
            |::..|.::.....|.|..|||:  :|..|| :..|.|.:        :|.:||        .::
  Fly   166 YRDDPDLQNFIDFAQQEFKCCGLSNSGYQDWSKNEYFNCSSPSVEKCGVPYSCCINATDISSGLV 230

  Fly   171 NL--------SEAKECTNTHATQHGCLQKLLEILDSKTLILASVVLGVAGIQMLTILFA 221
            |:        :...|.|....|. ||::.:....:....::|...||:|.||:|.|..|
  Fly   231 NIMCGYGVQNAPVPEATKLIWTS-GCIEIVRVWAEHNLYVIAGNALGIALIQLLVIYLA 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp39DNP_523612.3 Tetraspannin 8..227 CDD:278750 63/254 (25%)
tetraspanin_LEL 104..200 CDD:239401 26/123 (21%)
Tsp3ANP_001245504.1 Tetraspannin 42..295 CDD:278750 63/254 (25%)
penumbra_like_LEL 144..267 CDD:239411 26/123 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.