DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp39D and Tspan7

DIOPT Version :9

Sequence 1:NP_523612.3 Gene:Tsp39D / 35405 FlyBaseID:FBgn0032943 Length:235 Species:Drosophila melanogaster
Sequence 2:NP_062608.2 Gene:Tspan7 / 21912 MGIID:1298407 Length:249 Species:Mus musculus


Alignment Length:235 Identity:61/235 - (25%)
Similarity:113/235 - (48%) Gaps:21/235 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LTCVKYLTFFCNLLFALTGLLIFLVGGMVQLNYAHYSNFVSDHVWTAPIILMIVGAAVAVICFLG 70
            :||:|.|....:.:|.:||:::..||...:|....|.:.::::...||.:|:..|..:.|....|
Mouse    12 ITCLKTLLIIYSFVFWITGVILLAVGVWGKLTLGTYISLIAENSTNAPYVLIGTGTTIVVFGLFG 76

  Fly    71 CCGALKESSCMILSFALLAVVIFLFEIGLGLAGYVKHTGLHQIMES---QFNSTMQHYKERADYR 132
            |....:.|..|:..:|:...::||.|:..|::|:|..   |:|.::   .:...||:|....:..
Mouse    77 CFATCRGSPWMLKLYAMFLSLVFLAELVAGISGFVFR---HEIKDTFLRTYTDAMQNYNGNDERS 138

  Fly   133 DAWTLLQTELDCCGINGPNDWET--VYRNSTLPAACC---------SVINLSEAKECTNTHATQH 186
            .|...:|..|.|||:....:|.:  .:.:..:|.:||         .:.||:.|.    |...|.
Mouse   139 RAVDHVQRSLSCCGVQNYTNWSSSPYFLDHGIPPSCCMNETDCNPLDLHNLTVAA----TKVNQK 199

  Fly   187 GCLQKLLEILDSKTLILASVVLGVAGIQMLTILFACCLYR 226
            ||...:...:::...|:|.|..|:|..|::.:|.||||.|
Mouse   200 GCYDLVTSFMETNMGIIAGVAFGIAFSQLIGMLLACCLSR 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp39DNP_523612.3 Tetraspannin 8..227 CDD:278750 60/233 (26%)
tetraspanin_LEL 104..200 CDD:239401 23/109 (21%)
Tspan7NP_062608.2 Tetraspannin 15..237 CDD:395265 56/228 (25%)
TM4SF2_6_like_LEL 110..213 CDD:239414 23/109 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm43294
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
54.770

Return to query results.
Submit another query.