DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp39D and Tspan8

DIOPT Version :9

Sequence 1:NP_523612.3 Gene:Tsp39D / 35405 FlyBaseID:FBgn0032943 Length:235 Species:Drosophila melanogaster
Sequence 2:NP_001162150.1 Gene:Tspan8 / 216350 MGIID:2384918 Length:235 Species:Mus musculus


Alignment Length:247 Identity:74/247 - (29%)
Similarity:118/247 - (47%) Gaps:43/247 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SGGLTCVKYLTFFCNLLFALTGLLIFLVGGMVQLNYAHYSNFVSDHVWTAPI----ILMIVGAAV 63
            :|..:|:||..||.|.||.:.|.||..:...|:::........|....|.|.    ||:.||:.:
Mouse     2 AGVSSCLKYSMFFFNFLFWVCGTLILGLAIWVRVSKDGKEIITSGDSSTNPFIAVNILIAVGSII 66

  Fly    64 AVICFLGCCGALKESSCMILSFALLAVVIFLFEIGLGLAGYVKHTGLHQIMESQFNSTM------ 122
            .|:.|||||||:|||.||:|.|.:..::|.:.::..|:.|.......::|:    |.|:      
Mouse    67 MVLGFLGCCGAVKESRCMLLLFFIGLLLILILQVAAGILGAAFKPEYNRIL----NETLYENAKL 127

  Fly   123 --QHYKERADYRDAWTLLQTELDCCGI-NGPNDWETVYRNSTLPAACCSVINLSEAKE---CTNT 181
              .:..|..|::.|..:.|:|..|||: ||..||..               |..||||   ||.|
Mouse   128 LSDNTDEAKDFQKAMIVFQSEFKCCGLENGAADWGN---------------NFVEAKESCQCTGT 177

  Fly   182 H-ATQHG-------CLQKLLEILDSKTLILASVVLGVAGIQMLTILFACCLY 225
            . ||..|       ||..:.::.:...:|:..:..|:|.|::|.::|:..||
Mouse   178 DCATYQGSSVYPKTCLSLIKDLFEKNIIIVIGIAFGLAVIEILGLVFSMVLY 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp39DNP_523612.3 Tetraspannin 8..227 CDD:278750 73/242 (30%)
tetraspanin_LEL 104..200 CDD:239401 28/115 (24%)
Tspan8NP_001162150.1 Tetraspannin 8..228 CDD:366035 70/238 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.