DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp39D and Tspan8

DIOPT Version :9

Sequence 1:NP_523612.3 Gene:Tsp39D / 35405 FlyBaseID:FBgn0032943 Length:235 Species:Drosophila melanogaster
Sequence 2:NP_598210.1 Gene:Tspan8 / 171048 RGDID:621783 Length:235 Species:Rattus norvegicus


Alignment Length:242 Identity:67/242 - (27%)
Similarity:111/242 - (45%) Gaps:43/242 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 CVKYLTFFCNLLFALTGLLIFLVGGMVQLNYAHYSNFVSDHVWTAPI----ILMIVGAAVAVICF 68
            |:||..||.|.||.:.|.||..:...::::........|....|.|.    ||:.||:.:.|:.|
  Rat     7 CLKYSMFFFNFLFWVCGTLILGLAIWLRVSKDGKEIITSGDNGTNPFIAVNILIAVGSIIMVLGF 71

  Fly    69 LGCCGALKESSCMILSFALLAVVIFLFEIGLGLAGYVKHTGLHQIMESQFNSTM--------QHY 125
            ||||||:|||.||:|.|.:..::|.|.::..|:.|....:...:|:    |.|:        :..
  Rat    72 LGCCGAVKESRCMLLLFFIGLLLILLLQVAAGILGATFKSESSRIL----NETLYENAKLLSETS 132

  Fly   126 KERADYRDAWTLLQTELDCCGIN-GPNDWETVYRNSTLPAACCSVINLSEAKE---CTNTHATQH 186
            .|..:.:.|....|:|..|||:. |..||..               |..:|||   ||.:....:
  Rat   133 NEAKEVQKAMIAFQSEFKCCGLRFGAADWGK---------------NFPDAKESCQCTGSDCESY 182

  Fly   187 G--------CLQKLLEILDSKTLILASVVLGVAGIQMLTILFACCLY 225
            .        ||..:.|:::...:|:..:..|:|.|::|.::|:..||
  Rat   183 NGENVYRTTCLSLIKELVEKNIIIVIGIAFGLAVIEILGLVFSMVLY 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp39DNP_523612.3 Tetraspannin 8..227 CDD:278750 67/242 (28%)
tetraspanin_LEL 104..200 CDD:239401 22/115 (19%)
Tspan8NP_598210.1 Tetraspannin 8..228 CDD:395265 64/238 (27%)
TM4SF3_like_LEL 106..204 CDD:239407 23/116 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19282
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.