DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp39D and Cd63

DIOPT Version :9

Sequence 1:NP_523612.3 Gene:Tsp39D / 35405 FlyBaseID:FBgn0032943 Length:235 Species:Drosophila melanogaster
Sequence 2:NP_001036045.1 Gene:Cd63 / 12512 MGIID:99529 Length:238 Species:Mus musculus


Alignment Length:242 Identity:78/242 - (32%)
Similarity:129/242 - (53%) Gaps:22/242 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 GGLTCVKYLTFFCNLLFALTGLLIFLVGGMVQLNYAHYSNFVSDHVWTA----PIILMIVGAAVA 64
            ||:.|||:|.:...|.|....:.:..:|..||:....    ...|..||    |::::.|||.:.
Mouse     5 GGMKCVKFLLYVLLLAFCACAVGLIAIGVAVQVVLKQ----AITHETTAGSLLPVVIIAVGAFLF 65

  Fly    65 VICFLGCCGALKESSCMILSFALLAVVIFLFEIGLGLAGYVKHTGLHQIMESQFNSTMQHYKERA 129
            ::.|:|||||.||:.|::::||:...:|.|.|:.:.:||||....:.......|...||:|.:  
Mouse    66 LVAFVGCCGACKENYCLMITFAIFLSLIMLVEVAVAIAGYVFRDQVKSEFNKSFQQQMQNYLK-- 128

  Fly   130 DYRDAWTL--LQTELDCCGINGPNDWETV--YRNSTLPAACCSVINLSEAKECTN--THATQH-- 186
            |.:.|..|  ||.|.:|||.:...|||.:  .....:|.:||  ||::..  |.|  ..:|.|  
Mouse   129 DNKTATILDKLQKENNCCGASNYTDWENIPGMAKDRVPDSCC--INITVG--CGNDFKESTIHTQ 189

  Fly   187 GCLQKLLEILDSKTLILASVVLGVAGIQMLTILFACCLYRSFRRSYD 233
            ||::.:...|....|::|:..||:|.:::|.|:|:|||.:|.|..|:
Mouse   190 GCVETIAIWLRKNILLVAAAALGIAFVEVLGIIFSCCLVKSIRSGYE 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp39DNP_523612.3 Tetraspannin 8..227 CDD:278750 73/230 (32%)
tetraspanin_LEL 104..200 CDD:239401 30/103 (29%)
Cd63NP_001036045.1 Tetraspannin 10..227 CDD:395265 70/226 (31%)
CD63_LEL 105..203 CDD:239419 30/103 (29%)
Lysosomal targeting motif. /evidence=ECO:0000269|PubMed:21041449 234..238 1/3 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005733
OrthoInspector 1 1.000 - - otm43294
orthoMCL 1 0.900 - - OOG6_106877
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4418
SonicParanoid 1 1.000 - - X3621
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.740

Return to query results.
Submit another query.