DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp39D and Cd151

DIOPT Version :9

Sequence 1:NP_523612.3 Gene:Tsp39D / 35405 FlyBaseID:FBgn0032943 Length:235 Species:Drosophila melanogaster
Sequence 2:NP_001104519.1 Gene:Cd151 / 12476 MGIID:1096360 Length:253 Species:Mus musculus


Alignment Length:241 Identity:70/241 - (29%)
Similarity:111/241 - (46%) Gaps:13/241 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 ASGGLTCVKYLTFFCNLLFALTGLLIFLVGGMVQLNYAHYSNFVSDHVWTA-PIILMIVGAAVAV 65
            |:.|..|:|||.|..|..|.|.||.:..||.......:.|.:.::...:.| ..||::.|..|.|
Mouse     9 ATCGTVCLKYLLFTYNCCFWLAGLAVMAVGIWTLALKSDYISLLASSTYLATAYILVVAGVVVMV 73

  Fly    66 ICFLGCCGALKESSCMILSFALLAVVIFLFEIGLGLAGYVKHTGLHQIMESQFNSTM---QHYKE 127
            ...||||...||...::..:.:|.::|||.||..|:..||.:..|:..::.....||   .|...
Mouse    74 TGVLGCCATFKERRNLLRLYFILLLIIFLLEIIAGILAYVYYQQLNTELKENLKDTMVKRYHQSG 138

  Fly   128 RADYRDAWTLLQTELDCCGINGPNDWET-------VYRNSTLPAACCS--VINLSEAKECTNTHA 183
            ......|...||.|..|||.|...||:.       ...:..:|.:||.  |....:....:|.:.
Mouse   139 HEGVSSAVDKLQQEFHCCGSNNSQDWQDSEWIRSGEADSRVVPDSCCKTMVAGCGKRDHASNIYK 203

  Fly   184 TQHGCLQKLLEILDSKTLILASVVLGVAGIQMLTILFACCLYRSFR 229
            .:.||:.||...:.....::.:|.:|:|.:|:..::|.||||||.:
Mouse   204 VEGGCITKLETFIQEHLRVIGAVGIGIACVQVFGMIFTCCLYRSLK 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp39DNP_523612.3 Tetraspannin 8..227 CDD:278750 66/231 (29%)
tetraspanin_LEL 104..200 CDD:239401 25/107 (23%)
Cd151NP_001104519.1 Tetraspannin 15..248 CDD:278750 67/232 (29%)
CD151_like_LEL 112..220 CDD:239408 25/107 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4418
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.