DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp39D and cd151

DIOPT Version :9

Sequence 1:NP_523612.3 Gene:Tsp39D / 35405 FlyBaseID:FBgn0032943 Length:235 Species:Drosophila melanogaster
Sequence 2:XP_031755690.1 Gene:cd151 / 100144686 XenbaseID:XB-GENE-480009 Length:266 Species:Xenopus tropicalis


Alignment Length:249 Identity:73/249 - (29%)
Similarity:123/249 - (49%) Gaps:28/249 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 GLTCVKYLTFFCNLLFALTGLLIFLVGGMVQLNYAHYSNFVSDHVWTA-PIILMIVGAAVAVICF 68
            |..|:|||.|..|..|.|.||.:..||....:..:.|.:.:..:.:.| ..||:|.||.|.:...
 Frog    18 GTICLKYLLFTFNFFFWLAGLAVMAVGIWTLIQKSDYISLLPSNTYAATAYILVIAGAIVMITGI 82

  Fly    69 LGCCGALKESSCMILSFALLAVVIFLFEIGLGLAGYVKH-------TGLHQIMESQFNSTM-QHY 125
            ||||...||...::..:.:|.:.||:.|:..|:..|:.:       ..|:..::.....|| ..|
 Frog    83 LGCCATFKERKSLLKVYFILLLCIFILEVLAGILAYIYYQQCTPFCLQLNAELKQSLKQTMTTKY 147

  Fly   126 KERADYR--DAWTLLQTELDCCGINGPNDW-ETVYRNS------TLPAACCSVINLSEAKEC--- 178
            |:..:.:  :|...||.|..|||.|...|| ::::.||      .:|.:||..:    .:.|   
 Frog   148 KQPGEEKVTNAVDKLQQEFKCCGSNNSEDWRDSIWINSPEAEKRLVPDSCCKTV----TQRCGIR 208

  Fly   179 ---TNTHATQHGCLQKLLEILDSKTLILASVVLGVAGIQMLTILFACCLYRSFR 229
               :|.:.|:.||:.||...:.:..||:.:|.:|:|.:|:..::|.||||||.:
 Frog   209 DHPSNIYKTEGGCITKLETFIRAHLLIIGAVGIGIACVQLFGMIFTCCLYRSLK 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp39DNP_523612.3 Tetraspannin 8..227 CDD:278750 70/242 (29%)
tetraspanin_LEL 104..200 CDD:239401 28/118 (24%)
cd151XP_031755690.1 Tetraspannin 22..257 CDD:395265 66/238 (28%)
CD151_like_LEL 118..233 CDD:239408 28/118 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4418
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.