DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dimm and Olig3

DIOPT Version :9

Sequence 1:NP_001260674.1 Gene:dimm / 35404 FlyBaseID:FBgn0023091 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_443734.2 Gene:Olig3 / 94222 MGIID:2149955 Length:273 Species:Mus musculus


Alignment Length:206 Identity:69/206 - (33%)
Similarity:97/206 - (47%) Gaps:36/206 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 RVQQASS--GACPSTIAPNSTSSNSSNANGNASRRR-KGALNAKERNMRRLESNERERMRMHSLN 173
            |:...||  |.....:...|.|...:.|.|.:|:.: |..|:.::....||:.|.|||.|||.||
Mouse    37 RLNSVSSTQGDMVQKMPGESLSRAGAKAAGESSKYKIKKQLSEQDLQQLRLKINGRERKRMHDLN 101

  Fly   174 DAFQSLREVIP--HVEMERRLSKIETLTLAKNYIINLTHIILSKRNEEAAALELNSGAVGGVLLS 236
            .|...||||:|  |....|:||||.||.||:|||:.||           ::||.....||.:...
Mouse   102 LAMDGLREVMPYAHGPSVRKLSKIATLLLARNYILMLT-----------SSLEEMKRLVGEIYGG 155

  Fly   237 NLSSESGGPV--ASGIPANSNAAT----ICFEDTLASGGAFDCAILAATD----------GSLLN 285
            :.|:...|.|  ::|.||::..|.    ......|:||.|  .:.|:||.          .|||.
Mouse   156 HHSAFHCGTVGHSAGHPAHAANAVHPVHPILGGALSSGNA--SSPLSATSLPTIGTIRPPHSLLK 218

  Fly   286 AATVTTSPAMQ 296
            |.  :|.||:|
Mouse   219 AP--STPPALQ 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dimmNP_001260674.1 HLH 154..208 CDD:238036 30/55 (55%)
Olig3NP_443734.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..72 9/34 (26%)
HLH 86..139 CDD:306515 30/52 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3898
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19290
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.