DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dimm and neurod6

DIOPT Version :9

Sequence 1:NP_001260674.1 Gene:dimm / 35404 FlyBaseID:FBgn0023091 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_001072273.1 Gene:neurod6 / 779726 XenbaseID:XB-GENE-969227 Length:337 Species:Xenopus tropicalis


Alignment Length:244 Identity:73/244 - (29%)
Similarity:103/244 - (42%) Gaps:59/244 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   140 NASRRRKGALNAK------ER-NMRRLESNERERMRMHSLNDAFQSLREVIPHVEMERRLSKIET 197
            |...||:|....|      || .:||:|:|.|||.|||.||||..:||:|:|.....::||||||
 Frog    71 NGLPRRRGPRKKKMTKVRIERIKVRRVEANARERGRMHGLNDALDNLRKVVPCYSKTQKLSKIET 135

  Fly   198 LTLAKNYIINLTHII-LSKR-------------------NEEAAALELNSGAVGGVLLSNLSSES 242
            |.||||||..|:.|: :.||                   |..|..|:||:       .|.|.|:|
 Frog   136 LRLAKNYIWALSEILRIGKRPDLLTFVQSLCKGLSQPTTNLVAGCLQLNA-------RSFLMSQS 193

  Fly   243 G-------GPVASGIPANSNAATICFEDTLASGGAFD-------CAILAATDGSLLNAATVTTSP 293
            |       .|..|..|...:...    .|..|.|..|       .:..:|.:....:.:...|||
 Frog   194 GDTMHHTRSPYTSVYPPYHSPEL----STPPSHGTLDNSKTMKPYSYCSAYESFYESTSPECTSP 254

  Fly   294 AMQS-IQSQAIHLQTPMEQQQQQA------SHLPHHQQAMHGHGHLGAS 335
            ..:. :...:::.......:|::|      .:...|..||.|.|.||.|
 Frog   255 QFEGPLSPPSMNYNGIFSLKQEEALDYGKNYNYGMHYCAMAGRGPLGQS 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dimmNP_001260674.1 HLH 154..208 CDD:238036 32/54 (59%)
neurod6NP_001072273.1 bHLH_TS_NeuroD4_ATOH3 74..151 CDD:381564 39/76 (51%)
Neuro_bHLH 153..272 CDD:372170 23/129 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.